PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G233000.5.p
Common NamePRUPE_ppa004136mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 420aa    MW: 46671.6 Da    PI: 5.0973
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G233000.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4441e-135494191374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+e+L +cA+a++++d++ ++ l+++l++++s +g+p+qRl ay++e+L arla+s+s +y+al+++e +   s+e l+++++++e++P++
  Prupe.4G233000.5.p  49 LKEVLCACAKALANSDMSTTELLMSNLRQMVSVSGEPIQRLGAYMLEGLVARLASSGSAIYAALRCKEPA---SAELLSYMHILYEICPYF 136
                         5789*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI ea++ e+rvHiiDf++ qG QW++L+qaLa+Rp+gpp++RiTg+++++s   +   l  +g+rL+++Ae+++vpfef++
  Prupe.4G233000.5.p 137 KFGYMSANGAIAEAMKDESRVHIIDFQVAQGSQWITLIQALAARPGGPPQIRITGIDDSTSAyaRGGGLGLVGQRLSRLAESCKVPFEFHA 227
                         **********************************************************998899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +  + ++++le+++v+pgEa+aVn++++lh+++desvs +++rd++L+lvkslsPkvv++veqe+++n+++Fl rf+e+l+y+ a+fds+
  Prupe.4G233000.5.p 228 -AGISASEVQLENIEVRPGEAIAVNFAFMLHHMPDESVSCQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAPFLPRFAETLSYFRAVFDSI 317
                         .7889************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++ lpre++eri+vE+++l+reivn++aceg er+er e l+kW++r+ +aGF+p+pls+ ++ ++k+ll+ ++++ y++ee++g+l+lgW
  Prupe.4G233000.5.p 318 DVALPREHKERINVEQHCLAREIVNIIACEGMERVERYELLSKWKSRFIMAGFSPYPLSSLVNGTIKTLLQSYSEK-YTLEERDGALYLGW 407
                         **************************************************************************65.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         ++r Lv+ +aWr
  Prupe.4G233000.5.p 408 MNRVLVASCAWR 419
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.74923400IPR005202Transcription factor GRAS
PfamPF035143.5E-13349419IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MRELESVLLG NDLDAFDMYA ITDELGPNQL SSEAENWEQM MEMISRGDLK EVLCACAKAL  60
ANSDMSTTEL LMSNLRQMVS VSGEPIQRLG AYMLEGLVAR LASSGSAIYA ALRCKEPASA  120
ELLSYMHILY EICPYFKFGY MSANGAIAEA MKDESRVHII DFQVAQGSQW ITLIQALAAR  180
PGGPPQIRIT GIDDSTSAYA RGGGLGLVGQ RLSRLAESCK VPFEFHAAGI SASEVQLENI  240
EVRPGEAIAV NFAFMLHHMP DESVSCQNHR DRLLRLVKSL SPKVVTLVEQ ESNTNTAPFL  300
PRFAETLSYF RAVFDSIDVA LPREHKERIN VEQHCLAREI VNIIACEGME RVERYELLSK  360
WKSRFIMAGF SPYPLSSLVN GTIKTLLQSY SEKYTLEERD GALYLGWMNR VLVASCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-66514196375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227106.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_008227107.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM5X1200.0M5X120_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein