PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G233000.4.p
Common NamePRUPE_ppa004136mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 328aa    MW: 36467.9 Da    PI: 6.9304
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G233000.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4002.4e-122132745374
                GRAS  45 fteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasR 135
                         ++e+L arla+s+s +y+al+++e +   s+e l+++++++e++P++kf+++ aN aI ea++ e+rvHiiDf++ qG QW++L+qaLa+R
  Prupe.4G233000.4.p   1 MLEGLVARLASSGSAIYAALRCKEPA---SAELLSYMHILYEICPYFKFGYMSANGAIAEAMKDESRVHIIDFQVAQGSQWITLIQALAAR 88 
                         689**********************9...9************************************************************* PP

                GRAS 136 pegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleser 224
                         p+gpp++RiTg+++++s   +   l  +g+rL+++Ae+++vpfef++ +  + ++++le+++v+pgEa+aVn++++lh+++desvs +++r
  Prupe.4G233000.4.p  89 PGGPPQIRITGIDDSTSAyaRGGGLGLVGQRLSRLAESCKVPFEFHA-AGISASEVQLENIEVRPGEAIAVNFAFMLHHMPDESVSCQNHR 178
                         **************998899999************************.7889*************************************** PP

                GRAS 225 devLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                         d++L+lvkslsPkvv++veqe+++n+++Fl rf+e+l+y+ a+fds+++ lpre++eri+vE+++l+reivn++aceg er+er e l+kW
  Prupe.4G233000.4.p 179 DRLLRLVKSLSPKVVTLVEQESNTNTAPFLPRFAETLSYFRAVFDSIDVALPREHKERINVEQHCLAREIVNIIACEGMERVERYELLSKW 269
                         ******************************************************************************************* PP

                GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++r+ +aGF+p+pls+ ++ ++k+ll+ ++++ y++ee++g+l+lgW++r Lv+ +aWr
  Prupe.4G233000.4.p 270 KSRFIMAGFSPYPLSSLVNGTIKTLLQSYSEK-YTLEERDGALYLGWMNRVLVASCAWR 327
                         ******************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.8211308IPR005202Transcription factor GRAS
PfamPF035148.2E-1201327IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLEGLVARLA SSGSAIYAAL RCKEPASAEL LSYMHILYEI CPYFKFGYMS ANGAIAEAMK  60
DESRVHIIDF QVAQGSQWIT LIQALAARPG GPPQIRITGI DDSTSAYARG GGLGLVGQRL  120
SRLAESCKVP FEFHAAGISA SEVQLENIEV RPGEAIAVNF AFMLHHMPDE SVSCQNHRDR  180
LLRLVKSLSP KVVTLVEQES NTNTAPFLPR FAETLSYFRA VFDSIDVALP REHKERINVE  240
QHCLAREIVN IIACEGMERV ERYELLSKWK SRFIMAGFSP YPLSSLVNGT IKTLLQSYSE  300
KYTLEERDGA LYLGWMNRVL VASCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-61332749375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227106.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_008227107.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM5X1200.0M5X120_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein