PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G232600.3.p
Common NamePRUPE_ppa003305mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 492aa    MW: 54228.5 Da    PI: 6.6434
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G232600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.35.5e-32133190260
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Prupe.4G232600.3.p 133 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 190
                         8****************************************.***************85 PP

2WRKY106.51.3e-33308366159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Prupe.4G232600.3.p 308 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 366
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182906.8E-25131191IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.6E-27132191IPR003657WRKY domain
SMARTSM007744.1E-34132190IPR003657WRKY domain
PfamPF031061.4E-24133189IPR003657WRKY domain
PROSITE profilePS5081122.791133191IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37293368IPR003657WRKY domain
SuperFamilySSF1182901.83E-29300368IPR003657WRKY domain
PROSITE profilePS5081138.825303368IPR003657WRKY domain
SMARTSM007743.1E-39308367IPR003657WRKY domain
PfamPF031062.8E-26309366IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MVYGSLSSTT YSATTMCSDF DTFDERNSGS FEFKPHAGSN MVTTDYNHQR NDQLVQGQAQ  60
PQSLVSPPLV KSEMAVSSNE LSLSAPVHMV TSGASAPPEG DSDDLSQRGH PNPGVQTSQF  120
DHKGSGPSVI SSDDGYNWRK YGQKHVKGSE FPRSYYKCTH PNCEVKKLFE RSHDGQITEI  180
IYKGTHDHPK PQPSRRYNTG AMMPIQEERS EKASSLIGRD DKPSSIYGQM SSTNEPNSTP  240
ERSPVTGNDD SVEGTGSLSN RMAEEIDDDD PFSKRRRMDV GGVDVTPVVK PIREPRVVVQ  300
TLSEVDILDD GYRWRKYGQK VVRGNPNPRS YYKCTNAGCP VRKHVERASH DPKAVITTYE  360
GKHNHDVPTA RNSSHDTSGP TTVNGPSRIR SEESDTISLD LGVGINSAAE NKSNEHLQLH  420
SELMERQSHT SSNFKAIQTT PVSTYYGVLN SGMNQYGSRE NPSESRSIEI PPLNHSSYPY  480
PQNMGRVLTG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-37133368877Probable WRKY transcription factor 4
2lex_A5e-37133368877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G232600.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9333880.0KJ933388.1 Rosa hybrid cultivar Radrazz SUSI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214669.10.0probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV01e-179WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A251PPU10.0A0A251PPU1_PRUPE; Uncharacterized protein
STRINGEMJ158680.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.10.0WRKY family protein