PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G232600.1.p
Common NamePRUPE_ppa003305mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 587aa    MW: 63989.5 Da    PI: 6.4302
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G232600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017e-32228285260
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Prupe.4G232600.1.p 228 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 285
                         8****************************************.***************85 PP

2WRKY106.21.7e-33403461159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Prupe.4G232600.1.p 403 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 461
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182908.63E-25226286IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.2E-27227286IPR003657WRKY domain
SMARTSM007744.1E-34227285IPR003657WRKY domain
PROSITE profilePS5081122.791228286IPR003657WRKY domain
PfamPF031061.7E-24228284IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37388463IPR003657WRKY domain
SuperFamilySSF1182902.35E-29395463IPR003657WRKY domain
PROSITE profilePS5081138.825398463IPR003657WRKY domain
SMARTSM007743.1E-39403462IPR003657WRKY domain
PfamPF031063.5E-26404461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MDATTLDHPS GPSDDFDPGL TDFNPGSDPT LFSSTGGGGG AKYKLMSPAK LPISRSPCLT  60
IPPGLSPTSF LESPVLLSNM KAEPSPTTGS FLKPQMVYGS LSSTTYSATT MCSDFDTFDE  120
RNSGSFEFKP HAGSNMVTTD YNHQRNDQLV QGQAQPQSLV SPPLVKSEMA VSSNELSLSA  180
PVHMVTSGAS APPEGDSDDL SQRGHPNPGV QTSQFDHKGS GPSVISSDDG YNWRKYGQKH  240
VKGSEFPRSY YKCTHPNCEV KKLFERSHDG QITEIIYKGT HDHPKPQPSR RYNTGAMMPI  300
QEERSEKASS LIGRDDKPSS IYGQMSSTNE PNSTPERSPV TGNDDSVEGT GSLSNRMAEE  360
IDDDDPFSKR RRMDVGGVDV TPVVKPIREP RVVVQTLSEV DILDDGYRWR KYGQKVVRGN  420
PNPRSYYKCT NAGCPVRKHV ERASHDPKAV ITTYEGKHNH DVPTARNSSH DTSGPTTVNG  480
PSRIRSEESD TISLDLGVGI NSAAENKSNE HLQLHSELME RQSHTSSNFK AIQTTPVSTY  540
YGVLNSGMNQ YGSRENPSES RSIEIPPLNH SSYPYPQNMG RVLTGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36228463877Probable WRKY transcription factor 4
2lex_A1e-36228463877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G232600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9333880.0KJ933388.1 Rosa hybrid cultivar Radrazz SUSI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214669.10.0probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGEMJ158680.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein