PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G204800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 195aa    MW: 22364.2 Da    PI: 7.1299
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G204800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-173779145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        rg++++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+
  Prupe.4G204800.2.p 37 RGNFSPEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEIKNFWN 79
                        89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.67131IPR017877Myb-like domain
SuperFamilySSF466891.35E-211786IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-111743IPR009057Homeodomain-like
PROSITE profilePS5129424.7753286IPR017930Myb domain
SMARTSM007177.1E-163684IPR001005SANT/Myb domain
PfamPF002492.4E-153779IPR001005SANT/Myb domain
CDDcd001673.23E-123982No hitNo description
Gene3DG3DSA:1.10.10.603.2E-214480IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MEKENGAMLL RKLVGLNRSG KSCRLRWLNY LRPDVKRGNF SPEEEDLIIR MHKLLGNRWS  60
LIAGRLPGRT DNEIKNFWNI NLSKRVPEAR PRRIKINAKN DGADEGGNCT AKDDQVQVIQ  120
SITLNCTKAA AMIPSHHHLH DGDQRVNIQE QRVVDDISSS SFLRDLDNFI NDVLHESEIN  180
GDQYYVVDDQ EREY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-2038618103MYB3
3zqc_D2e-2038618103MYB3
3zqc_G2e-2038618103MYB3
3zqc_J2e-2038618103MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934080.0KT893408.1 Prunus persica cultivar Xiaobaitao r2r3-myb transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244405.11e-121PREDICTED: transcription factor TT2-like
TrEMBLM5WJ332e-94M5WJ33_PRUPE; R2r3-myb transcription factor (Fragment)
STRINGVIT_04s0008g01800.t013e-40(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.16e-41MYB family protein