PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G200200.1.p
Common NamePRUPE_ppa003323mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 586aa    MW: 65220.3 Da    PI: 5.8446
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G200200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.25.2e-1302155841373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+elL++cA a+s+++    ++l+++ +  +s +g+p+qRl ay++e+L ar   s+ ++y+al+++e +   s++ l+++++++e++P+l
  Prupe.4G200200.1.p 215 LKELLIACAGALSDNNIDSFDKLIEKARGAVSISGEPIQRLGAYLVEGLVARKEASGANIYRALRCREPE---SDDLLSYMQILYEICPYL 302
                         5799*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++g+rL+ + e++++p+ef+ 
  Prupe.4G200200.1.p 303 KFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWVTLLQALAARPGGAPHVRITGIDDPLSQyaRGDGLEAVGRRLKAISEKFNIPVEFHG 393
                         **********************************************************9998999************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v     d++ ++L+v+pgEalaVn+ lqlh+++desv+ +++rd +L++vkslsPkv ++veqe+++n+++F++rf+e+leyy a+f+s+
  Prupe.4G200200.1.p 394 -VPVFAPDVTQDMLDVRPGEALAVNFPLQLHHTPDESVDENNPRDGLLRMVKSLSPKVTTLVEQESNTNTTPFFNRFVETLEYYLAMFESI 483
                         .6888999*********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpr+++eri+vE+++l+r+ vnv+aceg+er+erhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lgW
  Prupe.4G200200.1.p 484 DVTLPRNNKERINVEQHCLARDMVNVIACEGKERVERHELFGKWKSRLTMAGFQQYPLSSYVNSVIRSLLRCYS-EHYTLVERDGAMLLGW 573
                         **********************************************************************9999.66************** PP

                GRAS 363 kdrpLvsvSaW 373
                         kdr+L+s+SaW
  Prupe.4G200200.1.p 574 KDRNLISASAW 584
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.134189566IPR005202Transcription factor GRAS
PfamPF035141.8E-127215584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MDSHQHFGFG VAGAGFSYTA PHSTVPSLPT RLLGSLKFDI GNSPNSPFST HFDSDTLTTL  60
SDGREQHSST ENLLGASPSC NSSFETNSYI HQLSFSPSVD CRRDSLQLYS GRTSVLQDAN  120
SSQNIKHALQ ELESTLMGPD NEEEEVTTPN TSFGESSKRQ TQRSTSWIQE HQGSPVVQRQ  180
ISFVSRQRQL CEFQIEKRPK VIDEGSLKGL PAGNLKELLI ACAGALSDNN IDSFDKLIEK  240
ARGAVSISGE PIQRLGAYLV EGLVARKEAS GANIYRALRC REPESDDLLS YMQILYEICP  300
YLKFGYMAAN GAIAEACRNE DRIHIIDFQI AQGTQWVTLL QALAARPGGA PHVRITGIDD  360
PLSQYARGDG LEAVGRRLKA ISEKFNIPVE FHGVPVFAPD VTQDMLDVRP GEALAVNFPL  420
QLHHTPDESV DENNPRDGLL RMVKSLSPKV TTLVEQESNT NTTPFFNRFV ETLEYYLAMF  480
ESIDVTLPRN NKERINVEQH CLARDMVNVI ACEGKERVER HELFGKWKSR LTMAGFQQYP  540
LSSYVNSVIR SLLRCYSEHY TLVERDGAML LGWKDRNLIS ASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-622155855375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214671.10.0hypothetical protein PRUPE_ppa003323mg
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM5X9Y90.0M5X9Y9_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein