PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G187100.1.p
Common NamePRUPE_ppa007577mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 364aa    MW: 40353.3 Da    PI: 8.2285
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G187100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.3e-53261531128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkkv++ +l++  +i+e+++yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Prupe.4G187100.1.p  26 LPPGFRFHPTDEELVVHYLKKKVTSAPLPV-AIIAEIELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 115
                         79****************************.88***************988899************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vl++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Prupe.4G187100.1.p 116 VLTSgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 153
                         **9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-6421187IPR003441NAC domain
PROSITE profilePS5100561.70926187IPR003441NAC domain
PfamPF023651.5E-2827153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MESTDSSTAS QQQQQQQPQP PPQPNLPPGF RFHPTDEELV VHYLKKKVTS APLPVAIIAE  60
IELYKFDPWE LPAKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLTSG  120
GTQKVGVKKA LVFYGGKPPK GIKTNWIMHE YRLADSKTSN KPPGCDLGNK KNSLRLDDWV  180
LCRIYKKNNS HRPMDLERED SMEDMMGPLM PPSISHVGHH QNMNLHLPKS NTNYGPPFIE  240
NDQIIFDGIM SSTDGSASLS NGTSQLPLKR SIVPSLYWND QEDDQTAGAS SSKRVVQLHQ  300
LDSGTNNSVA ANNNSTSIAN LLSQLPQTPP LHQHAMLGSL GDGLFRTPYQ LPGMNWFSES  360
NLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-75161907168NO APICAL MERISTEM PROTEIN
1ut4_B9e-75161907168NO APICAL MERISTEM PROTEIN
1ut7_A9e-75161907168NO APICAL MERISTEM PROTEIN
1ut7_B9e-75161907168NO APICAL MERISTEM PROTEIN
4dul_A9e-75161907168NAC domain-containing protein 19
4dul_B9e-75161907168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.7950.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}.
UniprotTISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G187100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227080.0KR822708.1 Prunus persica NAC transcription factor NAC1 (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211475.10.0NAC transcription factor 56
SwissprotQ9LD441e-122NAC56_ARATH; NAC transcription factor 56
TrEMBLM5WG300.0M5WG30_PRUPE; NAC transcription factor NAC1
STRINGEMJ126740.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-122NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zhou H, et al.
    Molecular genetics of blood-fleshed peach reveals activation of anthocyanin biosynthesis by NAC transcription factors.
    Plant J., 2015. 82(1): p. 105-21
    [PMID:25688923]