PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G186800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 350aa    MW: 39226.2 Da    PI: 8.243
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G186800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.1e-52141391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF Ptdeel+v+yL++kv+g +++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk 
  Prupe.4G186800.1.p  14 LPPGFRFYPTDEELLVQYLCRKVAGYQFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKI 103
                         79***************************9.89***************7777799***********************************9 PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Prupe.4G186800.1.p 104 ITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                         999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6610162IPR003441NAC domain
PROSITE profilePS5100560.17914162IPR003441NAC domain
PfamPF023657.0E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGYQ FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EPSRKNGSSK LDEWVLCRIY KKSSSSAAQK PMTTSVSSKE  180
HSNGSSSSCS SQLDDVLEWL PDIDDRCFTL PRINSLKTLQ QQQEDSKLGF QMGSGNFDWA  240
SLAGLNVVPE LCPNNQPQQS QGQMNVNYSN NDMYVPSIPP LCHVESPPER LAKTVDEEVQ  300
SGFRTQRVDN SGFFQNSNVM TQNFCNPTDP YGYSNRLGRS GLGFGGAEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11211664169NO APICAL MERISTEM PROTEIN
1ut4_B1e-11211664169NO APICAL MERISTEM PROTEIN
1ut7_A1e-11211664169NO APICAL MERISTEM PROTEIN
1ut7_B1e-11211664169NO APICAL MERISTEM PROTEIN
4dul_A1e-11211664169NAC domain-containing protein 19
4dul_B1e-11211664169NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G186800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227120.0KR822712.1 Prunus persica NAC transcription factor NAC5 (NAC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020418173.10.0NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-142JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A0P0KU830.0A0A0P0KU83_PRUPE; NAC domain-containing protein 72
STRINGEMJ127610.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-130NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Zhou H, et al.
    Molecular genetics of blood-fleshed peach reveals activation of anthocyanin biosynthesis by NAC transcription factors.
    Plant J., 2015. 82(1): p. 105-21
    [PMID:25688923]
  3. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  4. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]