PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G172000.2.p
Common NamePRUPE_ppa022385mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 333aa    MW: 37524.5 Da    PI: 6.5626
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G172000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.8e-11198243550
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Prupe.4G172000.2.p 198 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQSEVSALSPRVA 243
                         899**********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-15194258IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.772196248IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-14198249No hitNo description
PfamPF001701.0E-9198243IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-11198252No hitNo description
CDDcd147032.08E-23199249No hitNo description
PROSITE patternPS000360201216IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAQLPPKIPS MAQNWASFPH QRLPTTANFI PTTTTSAAVQ PPSQPQCNWI DEFLDFSSAR  60
RGVHRRSASD SIAFMESPLT LEEECRNPST AMMHHGSTNN LCFDRLDDEQ LMSMFSDDMS  120
VTVPPTVSSS NPSTPSDQNS NNDENNNNNN SNKLLMAHQE QQHQQHPKSE PGEDESSCEA  180
DPHAQSHPPP PTSPADPKRV KRILANRQSA QRSRVRKLQY ISELERSVTT LQSEVSALSP  240
RVAFLDHQRL ILNVDNSALK QRIAALAQDK LFKDAHQEAL KNEIERLRQV YHHQSLKKMG  300
NQNAQQQQHQ QQQQPNPDIM VCTDHNEQQI LN*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G172000.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007213497.10.0basic leucine zipper 34 isoform X2
SwissprotQ9M2K42e-99BZP61_ARATH; Basic leucine zipper 61
TrEMBLM5WN710.0M5WN71_PRUPE; Uncharacterized protein
STRINGEMJ146960.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-59bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]