PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G143600.1.p
Common NamePRUPE_ppa008801mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 325aa    MW: 36486.3 Da    PI: 8.0654
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G143600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.6e-52111351129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhP+deelv++yL kkv++++ +l   + evd++k+ePwd+p+++  + kewyf+s+rd+kyatg r+nrat++gyWkatgkd++
  Prupe.4G143600.1.p  11 LPPGFRFHPRDEELVCDYLLKKVTQTDSTL---MIEVDLNKCEPWDIPETACVGGKEWYFYSQRDRKYATGLRTNRATATGYWKATGKDRP 98 
                         79***********************99666...889************7777799************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ kg+lvg++ktLvfy+grapkg+k+dWvmhe+rle
  Prupe.4G143600.1.p  99 IHR-KGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRLE 135
                         **9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-602159IPR003441NAC domain
PROSITE profilePS5100556.34411158IPR003441NAC domain
PfamPF023659.4E-2712134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSNISMVEAK LPPGFRFHPR DEELVCDYLL KKVTQTDSTL MIEVDLNKCE PWDIPETACV  60
GGKEWYFYSQ RDRKYATGLR TNRATATGYW KATGKDRPIH RKGSLVGMRK TLVFYQGRAP  120
KGRKSDWVMH EFRLEGPFGP PKISSHKEDW VLCRVFYKNR EIAAKPSMGI SCYDDTSNSS  180
LPALMDSYIS FDGQPQTQPQ PQPQPHHEYE QVPCFSIFSQ SQTSPIFSHI DITGAHLEPN  240
MPTKNNNNNA ATFGALPNVT SFLDPFSCDK KVLKAVLSHL TKMEETSSYP TLNVKGSSPP  300
SLGAGSSSEN YLSEVGMPNI WSHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-50615912166NO APICAL MERISTEM PROTEIN
1ut4_B4e-50615912166NO APICAL MERISTEM PROTEIN
1ut7_A4e-50615912166NO APICAL MERISTEM PROTEIN
1ut7_B4e-50615912166NO APICAL MERISTEM PROTEIN
3swm_A4e-50615915169NAC domain-containing protein 19
3swm_B4e-50615915169NAC domain-containing protein 19
3swm_C4e-50615915169NAC domain-containing protein 19
3swm_D4e-50615915169NAC domain-containing protein 19
3swp_A4e-50615915169NAC domain-containing protein 19
3swp_B4e-50615915169NAC domain-containing protein 19
3swp_C4e-50615915169NAC domain-containing protein 19
3swp_D4e-50615915169NAC domain-containing protein 19
4dul_A4e-50615912166NAC domain-containing protein 19
4dul_B4e-50615912166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G143600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211642.20.0NAC domain-containing protein 21/22
SwissprotQ84TE61e-117NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A251PLZ80.0A0A251PLZ8_PRUPE; Uncharacterized protein
STRINGEMJ128410.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-113NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]