PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G138200.1.p
Common NamePRUPE_ppa012253mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 179aa    MW: 19543 Da    PI: 7.8175
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G138200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.24.7e-46131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+
  Prupe.4G138200.1.p  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQ 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la +++e
  Prupe.4G138200.1.p 104 TQLAIAQAE 112
                         ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.20112113IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MKESGRKQGA MSPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLAIAQ AEVVHMRMGQ  120
FSTSSTTSNA ATTTTCSPDQ KSTAPNHSHH HNHQTTKSFF TMDMVVDQAN MGESLWSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212145.11e-133hypothetical protein PRUPE_ppa012253mg
SwissprotQ9SHE94e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLM5WHZ51e-133M5WHZ5_PRUPE; Uncharacterized protein
STRINGSolyc11g045530.1.13e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-75LOB domain-containing protein 4