PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G126800.1.p
Common NamePRUPE_ppa017765mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 354aa    MW: 40265.6 Da    PI: 4.5151
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G126800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.1e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yL +k++g ++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd
  Prupe.4G126800.1.p   6 LPPGFRFHPTDEELVAYYLDRKINGLTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKD 95 
                         79****************************.99**************96435566888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  Prupe.4G126800.1.p  96 RAVNS-QRRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                         *****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-643157IPR003441NAC domain
PROSITE profilePS5100560.4316157IPR003441NAC domain
PfamPF023659.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING LTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVNS QRRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDSVCGN ASSSLKDSYA LCRVFKKTIQ MPKNNKEEKP IGIDNAENDS  180
VWVSSNEQLL MEDNSGINET ASRGIETDQD ENYSNHDYPK FLSDTSSSDL TQGTPTENGM  240
ADDFQAPFAS DEANSSAHLS FGVHCSSNLI DQETYIPHNE SLLNNYQFPY PPLELEDFPQ  300
INLAAETNAS KPEIIDDYMS YDKFKDYMNG TFEEIFSLCS SQDNSAALPM QEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-60115712165NO APICAL MERISTEM PROTEIN
1ut4_B3e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_A3e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_B3e-60115712165NO APICAL MERISTEM PROTEIN
3swm_A4e-60115715168NAC domain-containing protein 19
3swm_B4e-60115715168NAC domain-containing protein 19
3swm_C4e-60115715168NAC domain-containing protein 19
3swm_D4e-60115715168NAC domain-containing protein 19
3swp_A4e-60115715168NAC domain-containing protein 19
3swp_B4e-60115715168NAC domain-containing protein 19
3swp_C4e-60115715168NAC domain-containing protein 19
3swp_D4e-60115715168NAC domain-containing protein 19
4dul_A3e-60115712165NAC domain-containing protein 19
4dul_B3e-60115712165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G126800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214075.10.0NAC domain-containing protein 86
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGEMJ152740.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-109NAC domain containing protein 20