PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G105700.1.p
Common NamePRUPE_ppa012322mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 175aa    MW: 18947.5 Da    PI: 8.1357
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G105700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.92.7e-46141131100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+
  Prupe.4G105700.1.p  14 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQ 104
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++lal+++e
  Prupe.4G105700.1.p 105 TQLALAQAE 113
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0413114IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4514111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MKENGSRKQG APSPCAACKL LRRRCAQDCV FAPYFPADEP QKFANVHKVF GASNVNKMLQ  60
ELPEHQRGDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DVLQTQLALA QAEVVHLRVR  120
QTASFSNHGL SPASPSNSGS PSSKFMGSQS RPIFDMDMMV DHTSLGLGES MWSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.1230.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212152.11e-129hypothetical protein PRUPE_ppa012322mg
SwissprotQ9SHE91e-80LBD4_ARATH; LOB domain-containing protein 4
TrEMBLM5WJ971e-129M5WJ97_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s14880.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-77LOB domain-containing protein 4