PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G086800.1.p
Common NamePRUPE_ppa015145mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 266aa    MW: 28716.2 Da    PI: 6.9404
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G086800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.96.2e-428106199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvh+++Gasnv k+l++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq +l+q +
  Prupe.4G086800.1.p   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHRVYGASNVAKILNELNAAHREDAVTSLAYEAEARLRDPVYGCVGFISILQGKLKQIQ 98 
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         ++l  +k+
  Prupe.4G086800.1.p  99 TDLYNAKK 106
                         *9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.7287108IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-418105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFANV HRVYGASNVA KILNELNAAH  60
REDAVTSLAY EAEARLRDPV YGCVGFISIL QGKLKQIQTD LYNAKKDLSA YIGPQALMIP  120
VFHPSQQTDL NASVPMLGIS NCPPPQHGCG GGQLMQQQQQ LFEAHQQELV RYNVNGMDAA  180
AANSVTGNGF NQMHAAAGTN GVVSAGSLGL GGGFDNNPYN HQMQSQQAAA AAHHQHSLDY  240
QLQAQLMLQP HQAQQSQLKS EGEES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212478.10.0hypothetical protein PRUPE_ppa015145mg
SwissprotQ9FKZ34e-70LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ10.0M5WIQ1_PRUPE; Uncharacterized protein
STRINGGLYMA11G06210.28e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-64ASYMMETRIC LEAVES 2-like 1