PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G062400.5.p
Common NamePRUPE_ppa014847mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 418aa    MW: 48400.9 Da    PI: 8.3715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G062400.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.6e-3288141255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Prupe.4G062400.5.p  88 PRLRWTPQLHLSFVHAVERLGGQDRATPKLVLQLMNVKGLSISHVKSHLQMYRS 141
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8184144IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-3084142IPR009057Homeodomain-like
SuperFamilySSF466896.99E-1586142IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-2288143IPR006447Myb domain, plants
PfamPF002491.1E-889140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MTNEKDYGDQ EENTSEGSSQ LKCSSFDLNE EAGSDNCDDT KVEEFELSVD EDDEKRGQGN  60
INSSTASSAE GNERRRGKVR QYVRSKMPRL RWTPQLHLSF VHAVERLGGQ DRATPKLVLQ  120
LMNVKGLSIS HVKSHLQMYR SKKLDGDGQV VSEKQESTRG RDHIACMLHQ TIKQPRQHVY  180
FRTDNGGIVV ATPSHDHRQP LHSDFKPNVP RSSCSLLNEE VVQGNKSMDM TVRSTTVPIN  240
PSRFLEEKKW PPFGMINKQQ CWRAKRFPAK VSWSHNYNGS QSDHLVRHMR TTPRLNNEQF  300
FHNTRSTEWN LGENKNTRRF PSNSYNSISN SSCHKTEFEP PFRLELNEEK ILKYKEWMPE  360
LELGLSQRVE NHEKTIFQHQ MVSEEAYETA QRIKQNYYKE LEDRSKQEIS TKLSLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1689143458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G062400.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020417576.10.0putative two-component response regulator ARR21
RefseqXP_020417577.10.0putative two-component response regulator ARR21
RefseqXP_020417578.10.0putative two-component response regulator ARR21
TrEMBLA0A251PGL80.0A0A251PGL8_PRUPE; Uncharacterized protein
STRINGXP_008225297.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-36G2-like family protein