PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G055300.1.p
Common NamePRUPE_ppa019841mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 417aa    MW: 45893.9 Da    PI: 7.2975
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G055300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.6e-1857117257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Prupe.4G055300.1.p  57 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 117
                         89*****************99*************************************995 PP

2Wus_type_Homeobox1123.1e-3656118264
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Prupe.4G055300.1.p  56 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 118
                         689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-745116IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1253120IPR009057Homeodomain-like
PROSITE profilePS5007110.51153118IPR001356Homeobox domain
SMARTSM003896.8E-955122IPR001356Homeobox domain
CDDcd000868.50E-956118No hitNo description
PfamPF000462.3E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPANCS THHQWQHDIN PSLVSNGCHR PSYSSVAGCE ERSPEPKPRW  60
NPKPEQIRIL EAIFNSGMVN PPRDEIRKIR AQLQEYGQVG DANVFYWFQN RKSRSKHKLR  120
HLHNSSKQQT HHHTHLPLTT PVSTSTLNII NAAAPSSSSS SSEKSSPKSA PNNKAFSMGF  180
SSNVAAHDVS INSPTASVNQ QSSFFQPHHQ HHSELLPEPF FFPMHPNPNC NFTQGFCFSE  240
LSNVVDVPNH GTHEQTNTNT GPCTSLLLSE IMSHGAAMSR KEYHQEDEMK DMNMKNIDPH  300
HLNYSLNVTT TSPTSHTNMV ASHTNGPTTS VAVPSPMIHN IQGGVGEAGA MDAGGAEKST  360
VFINDVAFEV GAGPFNVREA FGDDAVLIHS SGHPVLTNEW GLTLHSLHHG AFYYLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212776.10.0hypothetical protein PRUPE_ppa019841mg
TrEMBLM5X4I80.0M5X4I8_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00560.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-65homeobox-3