PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G040900.1.p
Common NamePRUPE_ppa007314mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 374aa    MW: 41068.5 Da    PI: 8.8603
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G040900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.3e-53161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Prupe.4G040900.1.p  16 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 105
                         79****************************.89***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +l++ ++++vg+kk Lvfy g+ pkg k++W+mheyrl
  Prupe.4G040900.1.p 106 ILTSiGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRL 143
                         **9989999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-649176IPR003441NAC domain
PROSITE profilePS5100562.05116176IPR003441NAC domain
PfamPF023658.9E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MESTDSSSGS QAHPQLPPGF RFHPTDEELV VHYLKKKAAS APLPVTIIAE VDLYKFDPWE  60
LPSKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPILTSI GNQKVGVKKA  120
LVFYGGKPPK GIKSNWIMHE YRLVNNNNNF SKPPDASNKK ASLRLDDWVL CRIYKKNNAQ  180
RPMMDEDSSN NSMDGMFAHP SSILPAPPPP PPQPKHTTNY TALLENDDHE GFFEGILSSN  240
DQQGSHSHHH HQHHQHHQHH HDQFGGISTS SSKSNLPVKR PLSSSFWNDA GSMGTAAAAA  300
TTSSSSKRFH ADLNSGISAT AAGGVDESNS SFVSMLNQLP QGTAPFHSNA LLGSLGDGVL  360
RQQFQHPSMN WNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-751617917168NO APICAL MERISTEM PROTEIN
1ut4_B2e-751617917168NO APICAL MERISTEM PROTEIN
1ut7_A2e-751617917168NO APICAL MERISTEM PROTEIN
1ut7_B2e-751617917168NO APICAL MERISTEM PROTEIN
3swm_A2e-751617920171NAC domain-containing protein 19
3swm_B2e-751617920171NAC domain-containing protein 19
3swm_C2e-751617920171NAC domain-containing protein 19
3swm_D2e-751617920171NAC domain-containing protein 19
3swp_A2e-751617920171NAC domain-containing protein 19
3swp_B2e-751617920171NAC domain-containing protein 19
3swp_C2e-751617920171NAC domain-containing protein 19
3swp_D2e-751617920171NAC domain-containing protein 19
4dul_A2e-751617917168NAC domain-containing protein 19
4dul_B2e-751617917168NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during pollen development and maturation. {ECO:0000269|PubMed:21107887}.
UniprotTISSUE SPECIFICITY: Expressed specifically in the tapetum. {ECO:0000269|PubMed:21107887}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G040900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227090.0KR822709.1 Prunus persica NAC transcription factor NAC2 (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211453.10.0NAC transcription factor 25
SwissprotQ8GY421e-113NAC25_ARATH; NAC transcription factor 25
TrEMBLM5WFT20.0M5WFT2_PRUPE; NAC transcription factor NAC2
STRINGEMJ126520.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-104NAC domain containing protein 25
Publications ? help Back to Top
  1. Zhou H, et al.
    Molecular genetics of blood-fleshed peach reveals activation of anthocyanin biosynthesis by NAC transcription factors.
    Plant J., 2015. 82(1): p. 105-21
    [PMID:25688923]