PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G029400.1.p
Common NamePRUPE_ppa007317mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 374aa    MW: 40811.8 Da    PI: 7.6995
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G029400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57381.41.3e-251652421898
              DUF573  18 GlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                         G+id+ +k+g++p++d+ a+++f+kks++++v+k+q+ +KirrLKkK++++v+k   gk+ +  k+h+qk+f+lskk+Wgs
  Prupe.4G029400.1.p 165 GMIDYSTKKGADPYSDMGAVHDFIKKSLKADVNKTQVQDKIRRLKKKYEMNVAK---GKKYNPVKPHEQKVFDLSKKVWGS 242
                         9*****************************************************...999999****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.6E-23165241IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSEE EVASSEEEVD GEEEEESESE SDEPEPPKAT PTPVAENKPP  60
PKKPDSATVN SKPQSSSSGS EFKFESDSEL DKDMVVKPVS SKPMEETPKT KKPRSKASAT  120
TTPAARAGSK RPGESDPKDS KRPKKKIPDS DQEPDHAGEE MKKAGMIDYS TKKGADPYSD  180
MGAVHDFIKK SLKADVNKTQ VQDKIRRLKK KYEMNVAKGK KYNPVKPHEQ KVFDLSKKVW  240
GSGEGSIGVS GLSEQSNSNG KARTNQKGNN MTLASLKAEL LSSPEPQKEC EKVEFGSESL  300
SEVIGYDKGF RELGLPEGVV KQGLELIGGA KRAELKEKWK KLHVAELDLF VKRSELIRDQ  360
AKVILEALKS SKH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.57931e-172fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G029400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021828310.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLM5WTL30.0M5WTL3_PRUPE; Uncharacterized protein
STRINGEMJ126530.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-24DNA-binding storekeeper protein-related transcriptional regulator