PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G018700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 320aa    MW: 35868.7 Da    PI: 9.5015
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G018700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85e-3365118255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH++Fv+av++LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Prupe.4G018700.1.p  65 PRLRWTPDLHHCFVHAVKRLGGEQRATPKMVLQIMNVKGLTISHVKSHLQMYRS 118
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.2361121IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-3261120IPR009057Homeodomain-like
SuperFamilySSF466894.3E-1563119IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-2465119IPR006447Myb domain, plants
PfamPF002493.9E-866117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MKSSLKGSPS SSVDNGDDDD HQAGQRLVLY HHLLAAADHH QRSGLQKSPS WSSTPVRPYV  60
RSKMPRLRWT PDLHHCFVHA VKRLGGEQRA TPKMVLQIMN VKGLTISHVK SHLQMYRSMK  120
HEQGIQAAAM AAKKNGMFQA LEHPNNSNLL LKPINSNQPR YFQNNDGMQN MYNYGPCQGN  180
QTCYIEQLDL NTTSPLPKWK DEKKQAMWIE KKVTREQNPN SFIIFKDLLK RCTDAKESND  240
QGKAVSLVSA GCKSNHKEFE DLLLCEESES SMRVVSNNDA RMSLSLNSSP KASHELLRLS  300
KAAGNSDMND VSLELTLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1966121358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1966121358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1966121358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1966121358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1966121459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G018700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020418471.10.0transcription repressor KAN1
TrEMBLA0A251PEB60.0A0A251PEB6_PRUPE; Uncharacterized protein
STRINGXP_008384248.11e-116(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-33G2-like family protein