PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G000800.4.p
Common NameAPL, PRUPE_ppa009148mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 267aa    MW: 28914.7 Da    PI: 6.7396
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G000800.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.22.8e-1620502555
             G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        ++AtPk+i+++m+vkgLtl h+kSHLQkYRl
  Prupe.4G000800.4.p 20 QEATPKAIMRTMNVKGLTLFHLKSHLQKYRL 50
                        68****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-141951IPR009057Homeodomain-like
SuperFamilySSF466893.05E-61952IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-102051IPR006447Myb domain, plants
PfamPF143792.6E-1591136IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MFPRLMQAPH EGIAGQEDMQ EATPKAIMRT MNVKGLTLFH LKSHLQKYRL GKQSGKEMGD  60
VSKDASYLLE SPGTGNSSPN LPTSDLNEGY EVKEALRAQM EVQSKLHVQV EAEKHLQIRQ  120
DAERRYMAML ERACKMLADQ FIGGSVTDTD SHKCHGLGNK NTKGPSLDPL GFYSLQSTDV  180
AAVHGPEEEV PTSIHTQRAD CSTESCLTSH ESPGGLTLEG SPGGGKKRML SLDSAAASLI  240
WGEAKVRTQE INVAAVNPHG IARYGM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.206440.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G000800.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934050.0KT893405.1 Prunus persica cultivar Jinliuzaohong Myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211678.10.0protein PHR1-LIKE 3 isoform X3
TrEMBLA0A251PDI40.0A0A251PDI4_PRUPE; Uncharacterized protein
STRINGEMJ128770.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-40G2-like family protein