PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G000800.2.p
Common NameAPL, PRUPE_ppa009148mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 292aa    MW: 31736.9 Da    PI: 7.1788
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G000800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-333589155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerFv+av+qLGGs kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Prupe.4G000800.2.p 35 KPRLRWTADLHERFVDAVTQLGGSSKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 89
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-323290IPR009057Homeodomain-like
PROSITE profilePS512949.0153292IPR017930Myb domain
TIGRFAMsTIGR015571.7E-233589IPR006447Myb domain, plants
SuperFamilySSF466892.33E-163589IPR009057Homeodomain-like
PfamPF002491.8E-73788IPR001005SANT/Myb domain
PfamPF143793.0E-15116161IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MFPRLMQAPH EGIAGQEDMQ GHRGDPCLVL TSDPKPRLRW TADLHERFVD AVTQLGGSSK  60
ATPKAIMRTM NVKGLTLFHL KSHLQKYRLA SYLLESPGTG NSSPNLPTSD LNEGYEVKEA  120
LRAQMEVQSK LHVQVEAEKH LQIRQDAERR YMAMLERACK MLADQFIGGS VTDTDSHKCH  180
GLGNKNTKGP SLDPLGFYSL QSTDVAAVHG PEEEVPTSIH TQRADCSTES CLTSHESPGG  240
LTLEGSPGGG KKRMLSLDSA AASLIWGEAK VRTQEINVAA VNPHGIARYG M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-203592158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-203592158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-203592158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-203592158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-203592259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.206440.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G000800.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934050.0KT893405.1 Prunus persica cultivar Jinliuzaohong Myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224660.10.0PREDICTED: myb family transcription factor APL-like isoform X2
TrEMBLA0A251PDJ00.0A0A251PDJ0_PRUPE; Uncharacterized protein
STRINGEMJ128770.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-57G2-like family protein