PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G000800.1.p
Common NameAPL, PRUPE_ppa009148mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 306aa    MW: 33184.5 Da    PI: 7.1791
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G000800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.3e-333589155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerFv+av+qLGGs kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Prupe.4G000800.1.p 35 KPRLRWTADLHERFVDAVTQLGGSSKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 89
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.4993292IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-323290IPR009057Homeodomain-like
SuperFamilySSF466891.68E-163591IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-233590IPR006447Myb domain, plants
PfamPF002492.0E-73788IPR001005SANT/Myb domain
PfamPF143793.3E-15130175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MFPRLMQAPH EGIAGQEDMQ GHRGDPCLVL TSDPKPRLRW TADLHERFVD AVTQLGGSSK  60
ATPKAIMRTM NVKGLTLFHL KSHLQKYRLG KQSGKEMGDV SKDASYLLES PGTGNSSPNL  120
PTSDLNEGYE VKEALRAQME VQSKLHVQVE AEKHLQIRQD AERRYMAMLE RACKMLADQF  180
IGGSVTDTDS HKCHGLGNKN TKGPSLDPLG FYSLQSTDVA AVHGPEEEVP TSIHTQRADC  240
STESCLTSHE SPGGLTLEGS PGGGKKRMLS LDSAAASLIW GEAKVRTQEI NVAAVNPHGI  300
ARYGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-193591258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.206440.0fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G000800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934050.0KT893405.1 Prunus persica cultivar Jinliuzaohong Myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211678.10.0protein PHR1-LIKE 3 isoform X3
SwissprotQ94A572e-64PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLM5WGF60.0M5WGF6_PRUPE; Myb family transcription factor APL
STRINGEMJ128770.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.19e-67G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]