PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G310600.1.p
Common NamePRUPE_ppa026582mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 238aa    MW: 27315.8 Da    PI: 9.6844
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G310600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM118.28.1e-37151441128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         +p+G+rFhPtdeelv +yLk+kv++ +l++ ++i+++d+++++Pw Lp +    +++ yfF ++ ++++  + ++ra+  gyWk  gk+k+
  Prupe.3G310600.1.p  15 MPVGYRFHPTDEELVIHYLKRKVHAAPLPA-SIIPDFDVFHTHPWCLPGCGGDVREKRYFFYNQITANE-IDDTKRAAGCGYWKPMGKEKQ 103
                         699***************************.89***************654444446688888887764.67899999************* PP

                 NAM  92 vlsk.kgelvglkktLvfy...kgrapkgektdWvmheyrl 128
                         +++  ++e+vg++ktLvf    +  +++ +kt+W+mhey+l
  Prupe.3G310600.1.p 104 IVDPeSSEAVGIRKTLVFCrrkRRYHETQTKTRWLMHEYQL 144
                         **9967888**********54323445667*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-4211172IPR003441NAC domain
PROSITE profilePS5100541.65215172IPR003441NAC domain
PfamPF023655.2E-2416144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEKLPNFVIN GGVKMPVGYR FHPTDEELVI HYLKRKVHAA PLPASIIPDF DVFHTHPWCL  60
PGCGGDVREK RYFFYNQITA NEIDDTKRAA GCGYWKPMGK EKQIVDPESS EAVGIRKTLV  120
FCRRKRRYHE TQTKTRWLMH EYQLLSSQVN PTHTQASKRE LENWVVYRVF QRKRKPQRSS  180
DIISQPSNSK RTRTQRLVEA ITPSSSSSCS SDITHLSSNA NRLDHDQEEN SSAAADN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-251317815171NO APICAL MERISTEM PROTEIN
1ut4_B6e-251317815171NO APICAL MERISTEM PROTEIN
1ut7_A6e-251317815171NO APICAL MERISTEM PROTEIN
1ut7_B6e-251317815171NO APICAL MERISTEM PROTEIN
4dul_A6e-251317815171NAC domain-containing protein 19
4dul_B6e-251317815171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G310600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216529.10.0NAC domain-containing protein 41
TrEMBLM5X8831e-179M5X883_PRUPE; Uncharacterized protein
STRINGEMJ177281e-180(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-42NAC domain containing protein 83