PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G306000.1.p
Common NamePRUPE_ppa020857mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 376aa    MW: 42837.2 Da    PI: 5.4928
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G306000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.71.5e-181353343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i+++  r+vtf kR+ng++KKA+EL +LCd++v+ i++ ++
  Prupe.3G306000.1.p 13 IQDDKARKVTFRKRKNGLFKKAFELTTLCDVKVCTIVYEKK 53
                        8999*********************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-20164IPR002100Transcription factor, MADS-box
CDDcd002662.43E-22282No hitNo description
PROSITE profilePS5006617.661350IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-19583IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-10525IPR002100Transcription factor, MADS-box
PfamPF003192.8E-191353IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-102540IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-104061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGRRKTKLAL ELIQDDKARK VTFRKRKNGL FKKAFELTTL CDVKVCTIVY EKKSEGKLAP  60
PQTFPAKFEE VKEIIDKYKS NSSKIKKVQN LADFYATQTM QVKKEIVKLR TKSYEEKYPT  120
WDDRLNEYSL DQMQELLNNL EAKIQAAHKI HNMMMIDSKK PAIQDYIPPM ALVQSNLDPP  180
FLSMVDDQNP SNYGSMGMSE SGWDQFASAS TSWANNNIQY APSNVSDYKG TTSIWDYDLF  240
GIDAVPLQYG NMEEKPTFYN NNPMQPPYMH DPILSSAATT SQVEQQQLSV EHALDVPPIN  300
VAYDEPLSLS LQPSHTDCPV SAASFSFEYQ QFATSSQSES QSQSQSQSQS YVDDQVRMLY  360
DSMFQFKQNN VSTYK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G306000.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216884.20.0agamous-like MADS-box protein AGL82
TrEMBLA0A251QB970.0A0A251QB97_PRUPE; Uncharacterized protein
STRINGEMJ180830.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-19M-type_MADS family protein