PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G290800.1.p
Common NamePRUPE_ppa018381mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 176aa    MW: 19054.3 Da    PI: 8.361
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G290800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.82.2e-4412110199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
  Prupe.3G290800.1.p  12 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQ 102
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +el+++++
  Prupe.3G290800.1.p 103 KELDATNA 110
                         ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.67311112IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MASSSSSYTN SPCAACKFLR RKCMPDCIFA PYFPPEEPQK FANVHKIFGA SNVSKLLNEV  60
LPHQREDAVN SLAYEAEARM KDPVYGCVGA ISVLQRQVIR LQKELDATNA DLIRYAASSC  120
NNLEIPIASQ SGRTRTNSNM GHGGGSLGQN PGLYFSSPWN RSDSYGGDRN ERGGG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216921.11e-129hypothetical protein PRUPE_ppa018381mg
SwissprotQ9FML43e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLM5XGD21e-129M5XGD2_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s35280.14e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-72LBD family protein