PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G287700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 243aa    MW: 27044.7 Da    PI: 5.1553
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G287700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181657245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        + W++eEd++l++a+kq G++ W+ Ia++++ gRt++ +k++w+
  Prupe.3G287700.1.p 16 DMWSEEEDKILIEAHKQIGNK-WAEIAKRLP-GRTENTIKNHWN 57
                        67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.0E-17769IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-20862IPR009057Homeodomain-like
PROSITE profilePS5129421.9781064IPR017930Myb domain
SMARTSM007171.4E-141462IPR001005SANT/Myb domain
PfamPF002491.6E-161657IPR001005SANT/Myb domain
CDDcd001672.09E-131860No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVITCTYCVH ANLQKDMWSE EEDKILIEAH KQIGNKWAEI AKRLPGRTEN TIKNHWNATK  60
RKQNSKKKTN KDPNNNINPP ESSLLQDYIR SVVSSSSSFS SSSSSASSSA TTPKTSSAST  120
ETTETTEQRN ALSSDHSRGF YFNQNNAESA NWAQTAYHPD HISNETSNNM YSQMGGSVSN  180
LFNFESYGFG GSFLVDQVTE VEEYRGSSME AEMPLALEMQ GPDDDHVKKE MDLLEMICQG  240
KL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1idy_A5e-191363353MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
1idz_A5e-191363353MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216299.12e-99hypothetical protein PRUPE_ppa019507mg, partial
TrEMBLM5X7L22e-99M5X7L2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1709548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-24myb domain protein 98