PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G287600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 321aa    MW: 36049.2 Da    PI: 7.2365
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G287600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-17254300148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT++Ed llv++v+++G + W+ Ia+++  gR +kqc++rw+++l
  Prupe.3G287600.1.p 254 KGQWTPQEDRLLVQLVERFGIKKWSQIAKMLS-GRVGKQCRERWHNHL 300
                         799*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23248306IPR009057Homeodomain-like
SuperFamilySSF466898.97E-19249306IPR009057Homeodomain-like
PROSITE profilePS5129427.901249304IPR017930Myb domain
SMARTSM007171.7E-15253302IPR001005SANT/Myb domain
PfamPF002496.9E-16254300IPR001005SANT/Myb domain
CDDcd001678.11E-16257300No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MELETNLKEL DNFPFLSSVF SDSSTPMKLK PEHPSNTNNG INSLHPQLSS SSSSPPPNCK  60
PLFSSLVPHF DPHHQHLHLH HHHHHQPLHG SHLNLNSHSH DDFKTSSDHI NHFSTIEGSS  120
SNPFSGIYYN TNPHDFVAVP LAPDGIAFHG ARGSYWGAHH HHHLDAQEIP DGQAQMGPQS  180
CIQLPPLINF GDFGSSSPMA ISLPSDEVTC NSSSSTEIEF CKRLSAVDQK KTKRLCMRRP  240
TSSKVLQKKP SIFKGQWTPQ EDRLLVQLVE RFGIKKWSQI AKMLSGRVGK QCRERWHNHL  300
RPDIRSIEEN ERENGSDDEI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-19252314264C-Myb DNA-Binding Domain
1msf_C3e-19252314264C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230943.10.0PREDICTED: transcription factor MYB98-like
TrEMBLM5X7L20.0M5X7L2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1709548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-33myb domain protein 98