PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G273200.1.p
Common NamePRUPE_ppa023282mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 308aa    MW: 34334.7 Da    PI: 6.496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G273200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.35.9e-39241231100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rr+CakdC+l+p+fpa+qpk f+n+h+l+G+sn++k+ k++++e++++am+s++ye+++ra+ Pv G++g+i++l+ ql+q+ 
  Prupe.3G273200.1.p  24 ACAACKYQRRRCAKDCPLSPHFPADQPKMFQNAHRLYGVSNIMKIRKQVHPEQQNEAMRSIIYESNMRAKFPVTGCMGIINQLNFQLQQAI 114
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el +++++
  Prupe.3G273200.1.p 115 EELRYVRTH 123
                         ***999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.97123124IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3624121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MIIKTIDECT FYPTMTIKGG TSQACAACKY QRRRCAKDCP LSPHFPADQP KMFQNAHRLY  60
GVSNIMKIRK QVHPEQQNEA MRSIIYESNM RAKFPVTGCM GIINQLNFQL QQAIEELRYV  120
RTHLVICKDQ CQYRIPPSPP HYSSCPSSQL QLGMPSNNDA SAALTIYQHQ YQYASAGGGA  180
AGMSFVANEY LANGLSAVYI DDNDVVKPLR VQHPYYSDNN VDQLMAVQSN LVSSQAFPIH  240
QEMDVPHDYD DIPFDTIADD RQSYIESKDA CESSAESSFK GTTQSIEHVS QNDLKSAAAC  300
FSLTSVK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216458.10.0hypothetical protein PRUPE_ppa023282mg
TrEMBLM5WV190.0M5WV19_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000342888e-79(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-42LOB domain-containing protein 27