PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G269900.1.p
Common NamePRUPE_ppa020465mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 308aa    MW: 34893.8 Da    PI: 6.9341
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G269900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1889141456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Prupe.3G269900.1.p  89 KKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 141
                         4568889*********************************************9 PP

2HD-ZIP_I/II129.51.3e-4187177191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+ eqvk+LE+sFe+ +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lk+++dalk++n+ L++++++L++el
  Prupe.3G269900.1.p  87 EKKKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKKKFDALKADNDVLQDHNNKLQAEL 177
                         69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-1979145IPR009057Homeodomain-like
PROSITE profilePS5007117.02283143IPR001356Homeobox domain
SMARTSM003891.2E-1786147IPR001356Homeobox domain
CDDcd000866.93E-1788144No hitNo description
PfamPF000461.7E-1589141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1991151IPR009057Homeodomain-like
PRINTSPR000311.1E-5114123IPR000047Helix-turn-helix motif
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5123139IPR000047Helix-turn-helix motif
PfamPF021836.1E-14143183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMAFPPCHSF MFQTHEDPDL HLANSSSLNN LPSCPPQHFH GGGVPFMMKR SLSFSGVENN  60
KCHHHEEVGL HGGGEDDLSD DGSQIGEKKK RLNLEQVKTL EKSFEMGNKL EPERKMQLAK  120
ALGLQPRQIA IWFQNRRARW KTKQLEKDYD VLKKKFDALK ADNDVLQDHN NKLQAELLSM  180
KSKDSNEAGL NNNLKKETDQ GSWSNGSENS SDHHHHHHLN LDISRTPATT NSSPSNSQQI  240
NGKNLFPSSL RPTSITQLLQ GSSSRSDLQC LKVDQMIQDE SLCSMFNGID QEQQQGYWPW  300
PEQHHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARWKTKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G269900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216284.20.0homeobox-leucine zipper protein ATHB-20
SwissprotQ004661e-87HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A251Q6380.0A0A251Q638_PRUPE; Uncharacterized protein
STRINGEMJ174830.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-71homeobox 3