PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G268400.1.p
Common NamePRUPE_ppa016710mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 399aa    MW: 44493.7 Da    PI: 7.3867
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G268400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.9e-52141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yL++k++++ l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Prupe.3G268400.1.p  14 MLPGFRFHPTDEELVGFYLRRKIQQRLLPI-ELIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 103
                         579***************************.89***************9888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Prupe.3G268400.1.p 104 IYSSeGSKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 141
                         ***956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5713173IPR003441NAC domain
PROSITE profilePS5100556.88414173IPR003441NAC domain
PfamPF023651.9E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MDEKNDMDKI DDVMLPGFRF HPTDEELVGF YLRRKIQQRL LPIELIKQVD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGS KCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSLSESAPP PKKLLDKSLP ANDAWAICRI FKKTNSMAQR  180
ALSHSWGSPF PEPTAASGLL NQGAHCTQFS SENMSCTTDI GSSIQFWSNN DLQQASNASY  240
SAFDTLPYKP INPTGSKPSI FDADQFPNGF MFSPVEMSGP ISPALIGDLS NTTGSIDFDG  300
SQQQQFSGFS INLSQNQMQG NMETRENEGG FRKNLSSSTS HANNNNNNNN GQWGSIRPIA  360
FPFSLASDDD AWKPTLPSDS PPCPSDMSTS YSTNKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-521617617171Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G268400.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020414708.10.0protein FEZ
SwissprotQ9ZVH01e-103FEZ_ARATH; Protein FEZ
TrEMBLA0A251Q9C60.0A0A251Q9C6_PRUPE; Uncharacterized protein
STRINGEMJ188240.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-102NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]