PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G264600.1.p
Common NamePRUPE_ppa007883mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 353aa    MW: 40163 Da    PI: 7.0929
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G264600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.2e-56161421129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +kv ++ + + ++i evd++k+ePwdLp k+k +e+ewyfF+ rd+ky+tg r+nrat++gyWkatgkdke
  Prupe.3G264600.1.p  16 LPPGFRFHPTDEELISHYLSPKVLDSCFCA-TAIGEVDLNKCEPWDLPWKAKMGEREWYFFCVRDRKYPTGLRTNRATDAGYWKATGKDKE 105
                         79************************9888.88***************888999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++  ++lvg+kktLvfykgrapkgekt+Wvmheyrle
  Prupe.3G264600.1.p 106 IYK-AKTLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                         ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6313166IPR003441NAC domain
PROSITE profilePS5100559.38716166IPR003441NAC domain
PfamPF023653.3E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MENASGFSKE DEKMELPPGF RFHPTDEELI SHYLSPKVLD SCFCATAIGE VDLNKCEPWD  60
LPWKAKMGER EWYFFCVRDR KYPTGLRTNR ATDAGYWKAT GKDKEIYKAK TLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKYSAYNL PKTAKNEWVI CRIFQKSSGG KKTHISGLVR  180
LGSFGNELRP SLLPPLMDSS PYNSDTRTTV CETSHVSGFS DPMEDQRTQD DIIDSFQHNN  240
HHNSSNSNHN PLLNSSSRSN PSAHLNPFYS NQITPNIGFL QHQDSVLMQD QSFLRMLLEN  300
QAPNLRRSAK TELSQDTGLS MDVSSVVSNR EMVQDDPSYS SAPIEFDSLW NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531317214171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_B2e-531317214171NO APICAL MERISTEM PROTEIN
3swm_A2e-531317217174NAC domain-containing protein 19
3swm_B2e-531317217174NAC domain-containing protein 19
3swm_C2e-531317217174NAC domain-containing protein 19
3swm_D2e-531317217174NAC domain-containing protein 19
3swp_A2e-531317217174NAC domain-containing protein 19
3swp_B2e-531317217174NAC domain-containing protein 19
3swp_C2e-531317217174NAC domain-containing protein 19
3swp_D2e-531317217174NAC domain-containing protein 19
4dul_A2e-531317214171NAC domain-containing protein 19
4dul_B2e-531317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G264600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227110.0KR822711.1 Prunus persica NAC transcription factor NAC4 (NAC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215615.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-141NC100_ARATH; NAC domain-containing protein 100
TrEMBLM5WSZ20.0M5WSZ2_PRUPE; Uncharacterized protein
STRINGEMJ168140.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-130NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]