PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G222800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 530aa    MW: 58784.2 Da    PI: 6.5068
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G222800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.94.2e-901305152373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPi 90 
                         ++lLl+cA a++s+d +laq++++ l++ as+ gdp+qRl++ +++AL +r ++ +++ ++ ++ s++s++  ++ +++++l  ++++ P+
  Prupe.3G222800.1.p 130 EKLLLHCASALESNDVTLAQQVMWVLNNVASSVGDPNQRLTSWILRALISRASKVCPTPMN-FNGSTSSSTIPTRLMSVTELagYVDLIPW 219
                         689***************************************************8777775.5555555445666666666689******* PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfef 178
                         ++f++ + N+aI +a++g+ +vHi+Df+i++++QWp+L++aLa+Rpegpp lR+T+ +   ++    + + ee+g rL +f +  +vpfef
  Prupe.3G222800.1.p 220 HRFGYCASNSAIFKAIQGCPKVHILDFSITHCMQWPTLIDALAKRPEGPPLLRVTVPNWRPQVpplLNVSSEEVGLRLGNFSRFRDVPFEF 310
                         *******************************************************998755558899999********************* PP

                GRAS 179 nvlvak.rledl.....eleeLrvkpgEalaVnlvlqlhrll.........desvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                         nv+  + +le l     ++++L+++ +E+l+Vn++  l +l          ++++s    r+++L++++sl+P+++vvv++++d++++s+ 
  Prupe.3G222800.1.p 311 NVIENSsSLELLfstqlNPSSLDLQDDEVLVVNCQNWLRYLSdeqlggspgHQDGS---MRNTFLNMIRSLNPRIIVVVDEDSDLSAPSLS 398
                         **944436665566666999*********************944444333333333...677***************************** PP

                GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                          r++ +++y++  fdsle+ lp++s +r+ +E   +g +i+n++  eg +r+er et    ++r++++GF ++p+ e+++k++k ll +++
  Prupe.3G222800.1.p 399 SRITTCFNYMWIPFDSLETFLPKDSTQRMDYESD-IGHKIENIIGFEGHQRIERLETGVAMSQRIRNVGFLSAPFCEETVKEVKGLLDEHA 488
                         **********************************.******************************************************** PP

                GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                           g+ ++ e++ lvl+Wk+++ v+++aW
  Prupe.3G222800.1.p 489 -SGWGMKREEDMLVLTWKGHNSVFATAW 515
                         .889999999****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.379103497IPR005202Transcription factor GRAS
PfamPF035141.5E-87130515IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MFRRQKHISH TKAIDRFPLT QGLIYLLNLE THIPTDKTLA LQSHPPIFTG RVSSTQLSLS  60
SPSSSSSFSL KLLLFPHIFL IFTAMKTEVR GSTTSISLQN PTTIFNTSQG ASLTGALKGC  120
LGSLDGACIE KLLLHCASAL ESNDVTLAQQ VMWVLNNVAS SVGDPNQRLT SWILRALISR  180
ASKVCPTPMN FNGSTSSSTI PTRLMSVTEL AGYVDLIPWH RFGYCASNSA IFKAIQGCPK  240
VHILDFSITH CMQWPTLIDA LAKRPEGPPL LRVTVPNWRP QVPPLLNVSS EEVGLRLGNF  300
SRFRDVPFEF NVIENSSSLE LLFSTQLNPS SLDLQDDEVL VVNCQNWLRY LSDEQLGGSP  360
GHQDGSMRNT FLNMIRSLNP RIIVVVDEDS DLSAPSLSSR ITTCFNYMWI PFDSLETFLP  420
KDSTQRMDYE SDIGHKIENI IGFEGHQRIE RLETGVAMSQ RIRNVGFLSA PFCEETVKEV  480
KGLLDEHASG WGMKREEDML VLTWKGHNSV FATAWVANGP NPNGLLMED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-271275152374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230164.10.0PREDICTED: scarecrow-like protein 32
TrEMBLM5WVY80.0M5WVY8_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_12s0059g02770.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-120GRAS family protein