PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G219200.1.p
Common NamePRUPE_ppa014728mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 75aa    MW: 8530.15 Da    PI: 4.1953
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G219200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.83.3e-102567145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++ ++++E+ l+ + +++ G + W++Ia +++ gR+++++  +w 
  Prupe.3G219200.1.p 25 KLHFSEDEETLITRMFNLVGER-WSLIAGRIP-GRSAEEIEKYWT 67
                        5789******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.9342070IPR017877Myb-like domain
SMARTSM007171.8E-72472IPR001005SANT/Myb domain
SuperFamilySSF466891.17E-82770IPR009057Homeodomain-like
PfamPF002494.8E-92767IPR001005SANT/Myb domain
CDDcd001673.11E-72866No hitNo description
Gene3DG3DSA:1.10.10.606.7E-122868IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MADLDHSTSD DNSVDSREES SQDSKLHFSE DEETLITRMF NLVGERWSLI AGRIPGRSAE  60
EIEKYWTSRY STSE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.3671e-126fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230086.12e-47PREDICTED: transcription factor CPC-like
RefseqXP_008230085.12e-47PREDICTED: transcription factor CPC-like
RefseqXP_007216010.12e-47hypothetical protein PRUPE_ppa014728mg
SwissprotO220599e-17CPC_ARATH; Transcription factor CPC
TrEMBLM5WU462e-47M5WU46_PRUPE; Uncharacterized protein
STRINGVIT_12s0059g02360.t016e-39(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-18MYB_related family protein