PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G202000.3.p
Common NamePRUPE_ppa004905mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 487aa    MW: 52765.2 Da    PI: 6.6388
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G202000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY919.5e-29113170260
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         +Dgy+WrKYGqK vkg+ + rsYYrCt+++Cpvk++ver++ ++++++++Y geH h+k
  Prupe.3G202000.3.p 113 EDGYHWRKYGQKLVKGNAYVRSYYRCTHPKCPVKRQVERTH-NGQITDTVYFGEHGHPK 170
                         8***************************************9.***************85 PP

2WRKY1048.5e-33282340159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ++Dgy+WrKYGqK vkg+++prsYYrC+ +gCpvkk+ver+++d kvv+ tYeg+H+h+
  Prupe.3G202000.3.p 282 VNDGYRWRKYGQKLVKGNPNPRSYYRCSNPGCPVKKHVERASHDSKVVIATYEGQHDHD 340
                         58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-25105170IPR003657WRKY domain
PROSITE profilePS5081121.517107171IPR003657WRKY domain
SuperFamilySSF1182903.01E-23111170IPR003657WRKY domain
SMARTSM007741.2E-31112170IPR003657WRKY domain
PfamPF031066.3E-23113169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-35268342IPR003657WRKY domain
SuperFamilySSF1182903.53E-29274342IPR003657WRKY domain
PROSITE profilePS5081135.244277342IPR003657WRKY domain
SMARTSM007745.4E-38282341IPR003657WRKY domain
PfamPF031069.1E-26283339IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MISLGEPGTD KIASDIVPKK ESSNSEIHAP HQNPDNGICP LQSDHRGNVQ SLIPEKSLQL  60
PDGVGTASQS NQEGSVTSLT SEKAPQTPET SALVLRSGQE GSTPSTARER GLEDGYHWRK  120
YGQKLVKGNA YVRSYYRCTH PKCPVKRQVE RTHNGQITDT VYFGEHGHPK AQVSVPVAVS  180
FLVSIVEERP EELLLTGVEG KPSDVHGHTS NQIEPVDPSQ LSTVADNEGV QRVLSQSNRT  240
RDGDPDSKRQ KKEKHNGNSI PVDKPAGEPR VVVQTMSEAD IVNDGYRWRK YGQKLVKGNP  300
NPRSYYRCSN PGCPVKKHVE RASHDSKVVI ATYEGQHDHD MPPTRTVTHN AAASNVITTA  360
RNGESGTTSD GNAVCHDTSP KHEDKPNKQL NVEPRTKSSD VAGCDMVVDS ALGPERKLNE  420
QVVGKACTTE ESDAPDIIVP RANELQNGES GIKSEGNNAC IDTVVHGNLC PESNSPEQKN  480
PKAEPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-37112343275WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.68481e-96fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed to similar levels in root and flower, to a somewhat lower level in stem and to low levels in leaf and siliques. {ECO:0000269|PubMed:8972846}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G202000.3.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215284.10.0WRKY transcription factor 1
RefseqXP_020414488.10.0WRKY transcription factor 1
RefseqXP_020414489.10.0WRKY transcription factor 1
RefseqXP_020414490.10.0WRKY transcription factor 1
SwissprotQ9SI371e-86WRKY1_ARATH; WRKY transcription factor 1
TrEMBLM5X4P50.0M5X4P5_PRUPE; Uncharacterized protein
STRINGEMJ164830.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.29e-91zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]