PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G201900.5.p
Common NamePRUPE_ppa003702mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 556aa    MW: 62383.7 Da    PI: 6.9641
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G201900.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.94.1e-1381795491374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+++L+ cA+av+++dl laq+++ +l++++s +g+p+qRl ay++e+L ar a+s+s++ykal+++e +   sse l+++++++ev+P++
  Prupe.3G201900.5.p 179 LKQVLIFCAKAVADNDLLLAQWMMDELRQMVSVSGEPIQRLGAYLLEGLVARRASSGSNIYKALRCKEPA---SSELLSYMHILYEVCPYF 266
                         5799*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg++++ s   +   l+ +g+rL+k+Ae ++vpfef++
  Prupe.3G201900.5.p 267 KFGYMSANGAIAEAMKDENRVHIIDFQIGQGSQWLTLIQAFAARPGGPPHIRITGIDDSMSAyaRGGGLNIVGKRLSKLAELFKVPFEFHA 357
                         **********************************************************888789999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a +  +++l++L v+pgEala n++++lh+++desvs++++rd++L+lvkslsPkvv++veqe+++n++ F+ rf+e+l+yy+a+f+s+
  Prupe.3G201900.5.p 358 -AAMSGCEVQLKHLGVRPGEALAMNFAFMLHHMPDESVSTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFFPRFVETLNYYTAMFESI 447
                         .89999************************************************************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpr+++eri+vE+++l+re+vn++aceg er+erhe l+kWr r+++aGF+p+pls+ +++++k+ll ++++  yr++e++g+l+lgW
  Prupe.3G201900.5.p 448 DVTLPRDHKERINVEQHCLAREVVNIIACEGVERVERHELLGKWRLRFTMAGFTPYPLSSLVNATIKTLLDNYSD-KYRLQERDGALYLGW 537
                         **************************************************************************5.5************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r Lv+ +aW+
  Prupe.3G201900.5.p 538 KNRDLVASCAWK 549
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.883153530IPR005202Transcription factor GRAS
PfamPF035141.4E-135179549IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MQASKHHRSS GMSNRLCYQP VQEVEAYCLP RFQTLDPQVH YNNESSQSTV FSAQNFHIKY  60
CTLESSAANG SYTVYNSPST VNFSPNGSPM SQQDSHSYPP PDQYHSPDQN YSSPISGSCI  120
TDDATDFKYK LKQLETVMLG PDSNILDNYC STFQNGTSNT LPETDSWGQI MDSISKRDLK  180
QVLIFCAKAV ADNDLLLAQW MMDELRQMVS VSGEPIQRLG AYLLEGLVAR RASSGSNIYK  240
ALRCKEPASS ELLSYMHILY EVCPYFKFGY MSANGAIAEA MKDENRVHII DFQIGQGSQW  300
LTLIQAFAAR PGGPPHIRIT GIDDSMSAYA RGGGLNIVGK RLSKLAELFK VPFEFHAAAM  360
SGCEVQLKHL GVRPGEALAM NFAFMLHHMP DESVSTQNHR DRLLRLVKSL SPKVVTLVEQ  420
ESNTNTAAFF PRFVETLNYY TAMFESIDVT LPRDHKERIN VEQHCLAREV VNIIACEGVE  480
RVERHELLGK WRLRFTMAGF TPYPLSSLVN ATIKTLLDNY SDKYRLQERD GALYLGWKNR  540
DLVASCAWKC KPSTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-631815496375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.137691e-166fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215518.10.0hypothetical protein PRUPE_ppa003702mg
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM5WSC80.0M5WSC8_PRUPE; Uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein