PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G192100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 370aa    MW: 41365.8 Da    PI: 4.6879
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G192100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31104158155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWtp LH++Fv+a++qLGG++kAtPk++l+ m+vkg+tl+h+kSHLQkYRl
  Prupe.3G192100.1.p 104 KPRLRWTPHLHACFVDAINQLGGPHKATPKKLLQKMGVKGITLYHLKSHLQKYRL 158
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015573.9E-23104159IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.5E-29104158IPR009057Homeodomain-like
SuperFamilySSF466895.73E-15104158IPR009057Homeodomain-like
PfamPF002493.8E-6106157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MFHRGGGGGG SGVPNHTYNS QLLRAAALQP REEEEEKERM VGCGFDYFGD NEQDFQGPPT  60
PTVTQSDDSV VVEGEEEEEE EEEEEEEDLS HDLQTPSVLS SNFKPRLRWT PHLHACFVDA  120
INQLGGPHKA TPKKLLQKMG VKGITLYHLK SHLQKYRLGK YSVKEWKEVP ETFSQDFEGR  180
SVSSTSLCSS RSQKKHSSKL IKKALTQTEV EEKLGLQIEA EKRLKLRQDA ERRYMDYALD  240
NACKKLADQF LGSVAVDSAG VFRKDVAGLG TMVSIISQKD QFLPYDLSKE TSMQLSLEDQ  300
LGGFEAQREA YHETEGHLIS HGNSENSSVE DFQILADDDK IMEQSLDNDP AEAYLVLDTA  360
EMGTSSHRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-19104161158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-19104161158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-19104161158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-19104161158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-19104161259Protein PHOSPHATE STARVATION RESPONSE 1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193202KKHSSKLIKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G192100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020414715.10.0protein PHR1-LIKE 2
RefseqXP_020414716.10.0protein PHR1-LIKE 2
TrEMBLA0A251Q2J30.0A0A251Q2J3_PRUPE; Uncharacterized protein
STRINGXP_008229755.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1890145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.14e-39G2-like family protein