PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G187000.1.p
Common NamePRUPE_ppa005742mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 447aa    MW: 48568 Da    PI: 5.8041
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G187000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3759.8e-115844433374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                          lLl+cAe+v+ ++l +a+ lL ++ el+sp g++ +R+ ayf+ AL++r+ +s+ ++y+ l++++ +  +s++ ++al+ ++ +sP++kf
  Prupe.3G187000.1.p  84 GLLLQCAECVAMDSLDEASDLLPEIAELSSPFGSSPERVGAYFAHALQTRVISSCLGTYSPLTTKTLTLAQSQRIFNALQSYNSISPLVKF 174
                         58******************************************************************99********************* PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                         sh+t NqaI +a++ge++vH+iD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pfef++l  k
  Prupe.3G187000.1.p 175 SHFTSNQAIFQALDGEDHVHVIDLDIMQGLQWPGLFHILASRSKKIRSMRITGFGS----SSELLESTGRRLADFASSLGLPFEFRPLEGK 261
                         ********************************************************....9**************************9888 PP

                GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                           +  el++L v+p+Ea++V++++  h l+d ++s       +L+l+ sl+Pk+++++eq+++h s+sFl rf+eal+yysalfd+l  +l
  Prupe.3G187000.1.p 262 IGSITELSQLGVRPDEATVVHWMH--HCLYDVTGSDLA----TLRLLGSLRPKLITIAEQDLSH-SGSFLGRFVEALHYYSALFDALGDGL 345
                         88999******************9..888877777777....**********************.899*********************** PP

                GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         +++s er++vE++l+g ei+n++a  g +r+ + + +e+W + l+++GF+pv+l+ + a+qa+lll +++++gy++ ee+g+l lgWkd +
  Prupe.3G187000.1.p 346 GADSLERHMVEQQLFGCEIRNILAVGGPKRTGEVK-VERWGDELKRVGFRPVSLGGNPAAQASLLLGMFPWKGYTLVEENGCLKLGWKDLS 435
                         *****************************998887.9****************************************************** PP

                GRAS 367 LvsvSaWr 374
                         L+++SaW+
  Prupe.3G187000.1.p 436 LLTASAWQ 443
                         *******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.81456423IPR005202Transcription factor GRAS
PfamPF035143.4E-11284443IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MLQSLVPQSP IGAANPNNNP SSSSSSMKTK RVDRDLAGGE SSGEDPSFTK RPNSGRNFSR  60
EKTSDERETE PVAEGESAGL RLLGLLLQCA ECVAMDSLDE ASDLLPEIAE LSSPFGSSPE  120
RVGAYFAHAL QTRVISSCLG TYSPLTTKTL TLAQSQRIFN ALQSYNSISP LVKFSHFTSN  180
QAIFQALDGE DHVHVIDLDI MQGLQWPGLF HILASRSKKI RSMRITGFGS SSELLESTGR  240
RLADFASSLG LPFEFRPLEG KIGSITELSQ LGVRPDEATV VHWMHHCLYD VTGSDLATLR  300
LLGSLRPKLI TIAEQDLSHS GSFLGRFVEA LHYYSALFDA LGDGLGADSL ERHMVEQQLF  360
GCEIRNILAV GGPKRTGEVK VERWGDELKR VGFRPVSLGG NPAAQASLLL GMFPWKGYTL  420
VEENGCLKLG WKDLSLLTAS AWQPLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-50824434375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215383.10.0hypothetical protein PRUPE_ppa005742mg
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLM5WRZ70.0M5WRZ7_PRUPE; Uncharacterized protein
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein