PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G186100.3.p
Common NamePRUPE_ppa001511mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 840aa    MW: 97141.4 Da    PI: 7.0204
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G186100.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR188.41e-2776163191
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ ++++t+Cka+++vk++ dgkw ++++ +eHnHel p
  Prupe.3G186100.3.p  76 SFYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESDSG---TSRRPTVKKTDCKASMHVKRRADGKWIIHEFIKEHNHELLP 163
                         5****************************************999888...7788889*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-2576163IPR004330FAR1 DNA binding domain
PfamPF105512.4E-24283376IPR018289MULE transposase domain
PROSITE profilePS5096610.274563599IPR007527Zinc finger, SWIM-type
PfamPF044349.0E-6573596IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-7574601IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MDRNQNLGET VVDGPENMNG GRVSENMNMV AVVEEVQNRG GVVISSPKRD IQVFEGDTDF  60
EPCNGIEFES HEAAYSFYQE YAKSMGFTTS IKNSRRSKKS KEFIDAKFAC SRYGVTPESD  120
SGTSRRPTVK KTDCKASMHV KRRADGKWII HEFIKEHNHE LLPALAYHFR IHRNVKLAEK  180
NNIDILHAVS ERTRKMYVEM SRQSGGYQNT GFTTTDSNYQ FDKCRDLGLD EGDAQVMLEY  240
FKRIRKENPN FFYAIDLNEE QRVRNLFWVD AKSRSDYRSF NDVVSFDTSY IKTNDKLPFA  300
PFVGVNHHFQ SMLLGCALVA DDTKSTFVWL LKTWLRAMGG QCPKLVITDQ DQTLKAAIDE  360
VFPHARHCFT LWNILEKIPE TLAHVIKRHE NFLPKFNKCI FNSWTDEQFD LRWWKMVTRF  420
ELQDDEWIRL LYEDRKRWVP TYMGDTFFAG MCTTQRSESM NSFFDKYIHK KITLREFVKQ  480
YGTILQNRYE EEAIADFDTW HKQPALKSPS PWEKQMSTVY THAVFKKFQV EVLGVVGCQP  540
KKEHEDGPTT TFRVQDCEKD EYFMVTWNET KSEVSCSCRL FEYKGFLCRH SLIVLQICGL  600
SSIPFHYILK RWTKDAKSRQ SMVEETERVQ TRVQRYNDLC KRAIELSEEG SISEETYNIA  660
FRTLVEALKN CVNVNNSNNT VVDFSGTVHS IREAEEENQG SLASKTSRKK ITNRKRKVQA  720
EQDVILVEAQ DSLQQMDNLS SDGIPLPGYY GAQQNVHGLV QLNLMEPPHD SYYVNQQSMQ  780
GLGQLNSIAP NHDGFFGTQQ SIHGLGQLDF RPSTSFSYSL QDDPHLRSSQ LHGDASRHS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'. Activates the expression of FHY1 and FHL involved in light responses. Positive regulator of chlorophyll biosynthesis via the activation of HEMB1 gene expression. {ECO:0000269|PubMed:11889039, ECO:0000269|PubMed:12753585, ECO:0000269|PubMed:18033885, ECO:0000269|PubMed:22634759}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G186100.3.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated after exposure to far-red light. Subject to a negative feedback regulation by PHYA signaling. {ECO:0000269|PubMed:18033885}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217154.20.0protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_020415766.10.0protein FAR-RED IMPAIRED RESPONSE 1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A251Q2470.0A0A251Q247_PRUPE; Uncharacterized protein
STRINGXP_008229655.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein
Publications ? help Back to Top
  1. Domergue F, et al.
    Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.
    Plant Physiol., 2010. 153(4): p. 1539-54
    [PMID:20571114]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Wang C, et al.
    SCAB3 Is Required for Reorganization of Actin Filaments during Light Quality Changes.
    J Genet Genomics, 2015. 42(4): p. 161-8
    [PMID:25953354]
  4. Wang W, et al.
    A pair of light signaling factors FHY3 and FAR1 regulates plant immunity by modulating chlorophyll biosynthesis.
    J Integr Plant Biol, 2016. 58(1): p. 91-103
    [PMID:25989254]
  5. Ma L, et al.
    Arabidopsis FHY3 and FAR1 Regulate Light-Induced myo-Inositol Biosynthesis and Oxidative Stress Responses by Transcriptional Activation of MIPS1.
    Mol Plant, 2016. 9(4): p. 541-57
    [PMID:26714049]
  6. Siddiqui H,Khan S,Rhodes BM,Devlin PF
    FHY3 and FAR1 Act Downstream of Light Stable Phytochromes.
    Front Plant Sci, 2016. 7: p. 175
    [PMID:26941752]
  7. Liu L,Li B,Liu X
    FAR-RED ELONGATED HYPOCOTYL3 promotes floral meristem determinacy in Arabidopsis.
    Plant Signal Behav, 2016. 11(10): p. e1238545
    [PMID:27660915]
  8. Ma L,Xue N,Fu X,Zhang H,Li G
    Arabidopsis thaliana FAR-RED ELONGATED HYPOCOTYLS3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1) modulate starch synthesis in response to light and sugar.
    New Phytol., 2017. 213(4): p. 1682-1696
    [PMID:27859295]
  9. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  10. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]