PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G186000.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 836aa    MW: 95454.8 Da    PI: 7.059
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G186000.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR175.61e-23101187291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         +Y+eYA++vGF +++++s++sk++g++++ +  Cs+ g+++e+ ++    + +   t+t+Cka+l++k+++dgkw+v+++ +eHnHe++p
  Prupe.3G186000.6.p 101 YYREYARSVGFGITIKASRRSKKSGKFIDIKIACSRFGSKRESGTT---VNPRLCITKTDCKASLHIKRKDDGKWVVHSFIKEHNHEMCP 187
                         9*****************************************9888...5666789********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-21101187IPR004330FAR1 DNA binding domain
PfamPF105511.0E-25270361IPR018289MULE transposase domain
PROSITE profilePS5096610.138549585IPR007527Zinc finger, SWIM-type
PfamPF044342.4E-7549582IPR007527Zinc finger, SWIM-type
SMARTSM005752.3E-7560587IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MEIDLELPSC ERDKLVTGSD KDVNVVDVTD EKNVEEHVNS PTTSEHVKEA DGLDANQSAC  60
SLQAQDDAKN MGLNAVDEGK RVIQEPQNGL EFESKEEAYS YYREYARSVG FGITIKASRR  120
SKKSGKFIDI KIACSRFGSK RESGTTVNPR LCITKTDCKA SLHIKRKDDG KWVVHSFIKE  180
HNHEMCPDDF IYAISGRNKK PATVVCQKKG LQSALGQEDV RVMFEHFMCM QDEDPNFFYA  240
VDFDHEKRLR SVFWIDAKCR HDYSSFCDAV FFDTYYVRNN YRIPFVPIVG VNHHFQYILL  300
GCALMGEETI PAFVWLMQTW LKVVGGQAPR LIITDQDKYL KEAVADVFTD AYHCFCLWHV  360
LTRIPENVGF FIKENEIFME KFNKCIYRSW TVEQFEKKWW KLVDRFELRE NAWVHSLFED  420
RKKWVPTYMQ DSFMAGMSTK ERSGSITSFF DRYISQEATV NDFIEQYKGF QKDMYDMEVN  480
AVLETQDKQP GLRSLSPFEK QMATIYTGSV FKKFKVEVLG LASCQLQKDG ENEATAIFQV  540
DDLEERQNFT VSWNEAELKV CCSCHSFEYN GFLCRHAILV LQVSGVSGIP SHYILKRWTK  600
DAKVRCTVSD GPKRLNYRVQ RFNDLCKLAV KLGEEGSLSP EAYHIAFQAL EAALKHCVDA  660
NNSVRTVSEA NMSANHGFND VEEVNPSSNM AKSSKKKKTY KKRKAQTEQD SGTIRLQDSC  720
QQMEHGSRSR GLDSYYGAQQ SMQGMGQLNS IAPISDGYYC NQQATQGQLH SLPTRVGHYG  780
TQQSMRGMGQ LSFRSPTVQS CFDIQGNLQD MEQSAGSSHF HGNASKRLHG KHQTQ*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G186000.6.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020415066.10.0protein FAR1-RELATED SEQUENCE 2 isoform X2
SwissprotQ3EBQ30.0FRS2_ARATH; Protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A251Q2E80.0A0A251Q2E8_PRUPE; Uncharacterized protein
STRINGXP_008229651.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32250.40.0FAR1-related sequence 2
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]