PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G178600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 240aa    MW: 27553.6 Da    PI: 6.9723
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G178600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.5e-312274254
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                        prlrWtp+LHe Fveave+LGG++kAtPk+il++m+vkgL ++hvkSHLQ+YR
  Prupe.3G178600.1.p 22 PRLRWTPQLHELFVEAVESLGGKHKATPKRILQTMSVKGLKISHVKSHLQMYR 74
                        9**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0021878IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-281974IPR009057Homeodomain-like
SuperFamilySSF466891.76E-142175IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-232274IPR006447Myb domain, plants
PfamPF002493.5E-82374IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MNEEMKSYQK IGVRNYQKSD HPRLRWTPQL HELFVEAVES LGGKHKATPK RILQTMSVKG  60
LKISHVKSHL QMYRGVNDNA HSQDHSSNVF SIFSPQTQTQ RPSENYYLRY EPHVMFSETD  120
EETKGRILTR EEAAGKQQNQ VLQAQKYHLH QTSFEKNAHT PELSRLSMDE ETCQLYGFSE  180
LSLSFNPTVT TMAQFRKESK LWPSADEHNT SQSSSTGNFS NIQDFQEVGS NDINLDLTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-182374455Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G178600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217678.20.0putative Myb family transcription factor At1g14600 isoform X1
TrEMBLA0A251Q5531e-179A0A251Q553_PRUPE; Uncharacterized protein
STRINGXP_008229586.11e-157(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-27G2-like family protein