PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G127700.1.p
Common NamePRUPE_ppa014599mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 542aa    MW: 59173.7 Da    PI: 6.5333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G127700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27233287156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Prupe.3G127700.1.p 233 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 287
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.152230289IPR017930Myb domain
SuperFamilySSF466894.48E-18231290IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-26231290IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-26233287IPR006447Myb domain, plants
PfamPF002496.3E-8236285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MLILSPLRDG HHQLKEEKQL GGGGRDEGEV EGFDFNGGNS VGSAGLDFPE FSGGMGNLLD  60
SIDFDDLFIG IHDGDVLPDL EMDSEILDFS AHRDHGDEYY HNNAKTTSSK VEDQEEEEEE  120
EEEGKDRVRA AADSLTNATT TRNNQTYSSS SNTSTTTTSA TQDQDRDGGH EEIGSKGNCN  180
SNINNNISQI RASQHEQNQL LNQSSSPKES ADQKLARKSS STAQSKNSHG KRKVKVDWTP  240
ELHRRFVQAV EQLGVDKAVP SRILELMGID CLTRHNIASH LQKYRSHRKH LLAREAEAAS  300
WTQRRQMYGA ATVSGGGGGG GGGGGKSSRY DVMMMNSPNW LNAPTMGFPP IPSPTPPSMH  360
HHHHHQMIRP LHVWGHPSMD QSMMHMWPKH LPHNFPSPIP PPPPPAHAWP PPPPPPSDAS  420
YWHHPPPHHQ RVPNALTPGT PCFPRQLATA TQQRFPAPPV PGIPPHAMYK VDTGIAVPSP  480
QSGPHPLVDF HPSNESIDAA IGDVLSKPWL PLPLGLRPPA TDSVMVELQR QGIPKIPPSC  540
A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16230285257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G127700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090022e-51AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020416310.10.0transcription activator GLK1 isoform X1
TrEMBLA0A251PZA30.0A0A251PZA3_PRUPE; Uncharacterized protein
STRINGEMJ225510.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.19e-71GBF's pro-rich region-interacting factor 1