PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G126300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 231aa    MW: 25907.4 Da    PI: 8.5553
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G126300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.41.3e-3414105192
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++r+kC ++Cvlapyfpa+++++f +vhk+FG+snv+k++k+++e +r+++++slv+eA +r++dPv G +g ++ +  +l++ k
  Prupe.3G126300.1.p  14 ACAACKHQRKKCHDGCVLAPYFPADRTREFLAVHKVFGVSNVTKMVKNANEANRRKVVDSLVWEALCRQKDPVLGPYGEYRMVFDELKRYK 104
                         7******************************************************************************999999999887 PP

              DUF260  92 a 92 
                         +
  Prupe.3G126300.1.p 105 N 105
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.11113115IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-3314105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MQRKNNGTPG TQPACAACKH QRKKCHDGCV LAPYFPADRT REFLAVHKVF GVSNVTKMVK  60
NANEANRRKV VDSLVWEALC RQKDPVLGPY GEYRMVFDEL KRYKNHEIQM VHPSQVQKGM  120
CFSKSLSDFV GWNCGGANGI SNHNINLGGY LHENENVIID SASYGYPSNC ELQSPENIIK  180
QAKLVDSVVL PLNQHQQRSI NNINQQYYLS GQLNQIISKP IEDTIWEGGT *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229134.11e-159PREDICTED: LOB domain-containing protein 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.17e-43LOB domain-containing protein 2