PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G125500.1.p
Common NamePRUPE_ppa016271mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 314aa    MW: 35141.9 Da    PI: 6.653
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G125500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.5e-11185228548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Prupe.3G125500.1.p 185 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 228
                         8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-14181245IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622183235IPR004827Basic-leucine zipper domain
PfamPF077164.2E-9183230IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.02E-11185239No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-11185236No hitNo description
CDDcd147032.50E-23186236No hitNo description
PROSITE patternPS000360188203IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAQLPPKIPS MTPSWPDFSH QKMPPMGHFA PNGNAPAVNA TTASQNSCWV DEFIDFSSAR  60
RGSHRRSVSD SITFLETPMQ DECRAPHGSH PNNHEFDRFD DEQFMSMFTT EEISAAAAAA  120
GPTGSSSNPS SPSDHNSINE DEKEADAPHH KQLKNESEEV ESQCEQPNPN DTTKSKSNDR  180
KIDPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTSLQA EVSVLSPRVA FLDHQRLLLN  240
VDNSALKQRI AALAQDKIFK DAHQEALKRE IERLRQVYHQ QNLKKMENVA QSPTPPSDTI  300
TTPEKEQLLN VSS*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G125500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212389.10.0basic leucine zipper 61
SwissprotQ9M2K41e-123BZP61_ARATH; Basic leucine zipper 61
TrEMBLM5WW510.0M5WW51_PRUPE; Uncharacterized protein
STRINGEMJ135880.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20113488
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-113bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]