PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G116700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 231aa    MW: 25920.9 Da    PI: 6.9552
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G116700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-31111164255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +F++ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Prupe.3G116700.1.p 111 PRLRWTPDLHLAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 164
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.727107167IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-29107165IPR009057Homeodomain-like
SuperFamilySSF466891.79E-14109165IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-23111166IPR006447Myb domain, plants
PfamPF002492.0E-9112163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLSGGPKEIY RRDMAPERIE ISDEDDQSSD ASYEIQAKND CLRSSQKCLF FDLNEEASIG  60
DDDQDVSSSN EGTQAVGSRI SPVGNLSCNN TSVEGKERTI AVRQYVRSKM PRLRWTPDLH  120
LAFIHAVERL GGQERATPKL VLQLMNVRGL SIAHVKSHLQ MYRSKKLDES GQVISQSSRG  180
MQVKDHILEA YRKFNPYGHL RHVDDNGSHF ASPPVLKQQP YDDFNANSSR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-19112166357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-19112166357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-19112166357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-19112166357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G116700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934060.0KT893406.1 Prunus persica cultivar Xiaobaitao putative Myb family transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020415477.11e-169uncharacterized protein LOC18782555
TrEMBLA0A251PYW31e-171A0A251PYW3_PRUPE; Uncharacterized protein
STRINGXP_008228923.11e-151(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-41G2-like family protein