PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G071200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 137aa    MW: 15319.6 Da    PI: 8.4945
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G071200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26082.94.9e-261385173
              DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73
                        aCa+C ++rrkC + C +apyfpa++ ++f+n+hk+F +sn++k+++ + +++r++a++sl  e++ar +dP 
  Prupe.3G071200.1.p 13 ACASCNHQRRKCDETCEMAPYFPASRYNEFQNAHKIFCVSNIQKIMAMAAPDQRQAAAESLPTEGNARKNDPD 85
                        7***********************************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.0412112IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-231384IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MENRDQGAAQ NHACASCNHQ RRKCDETCEM APYFPASRYN EFQNAHKIFC VSNIQKIMAM  60
AAPDQRQAAA ESLPTEGNAR KNDPDLLLID TISCNEAIKL IGSNIKLYKL PLVSLRQLQA  120
PMLMPLRQSD RRCKPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216281.11e-57hypothetical protein PRUPE_ppa020441mg, partial
TrEMBLM5XEJ02e-57M5XEJ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.18e-19LOB domain-containing protein 2