PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G049100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 363aa    MW: 41182.3 Da    PI: 7.0301
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G049100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.68.8e-38901891100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkCa+dC+lap fp++++++f n+hklFG+sn++k++k+l+ +++e+am+++++++++ra+dPv G++++i++lq+ +e  k
  Prupe.3G049100.1.p  90 ACAACKYQRRKCAPDCILAPFFPHDRQRQFLNAHKLFGVSNITKIIKHLNLSDKEEAMRTIIFQSDIRANDPVGGCYRIIRELQRLIEYNK 180
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael+ + ++
  Prupe.3G049100.1.p 181 AELDIVLHQ 189
                         ***988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.13289190IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3590185IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MCPPFLSSLP IPHPTSPFIS IEKIRETPQK KKPHQEKKPP LPPPPETHSI TNNTSTQKEI  60
IMSSISNHTH HQIPTPTTPT TTKGNGNAQA CAACKYQRRK CAPDCILAPF FPHDRQRQFL  120
NAHKLFGVSN ITKIIKHLNL SDKEEAMRTI IFQSDIRAND PVGGCYRIIR ELQRLIEYNK  180
AELDIVLHQL AICRAQAQAQ QQQQQNQIQI PEVGDQNSCD QLINMDPLSF YNNQVAHYHY  240
VQPHPHALPA VQQQQQQQEV PYVLVQNNNI NSPNSNSNNN NNNPHQHLHE DMNMWAMQDS  300
MSSLDIKHGG GMNANDCEDL KPFVEIPCDD DQRNGEVRFQ PEDIGDHQQR FVVPNTKLLI  360
SS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228290.11e-180PREDICTED: LOB domain-containing protein 22
TrEMBLA0A067L9L15e-77A0A067L9L1_JATCU; Uncharacterized protein
STRINGGLYMA07G01170.22e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-49LOB domain-containing protein 22