PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G046700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 670aa    MW: 73850.5 Da    PI: 6.3113
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G046700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573114.85.1e-36170264198
              DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                         klfqr+ws++Dei++L+G+id+ +k+g++p++d+ af++f+kks++++v+k+ql +Kirr+KkK++++v+k   gk+ +  k+h+qk f+l
  Prupe.3G046700.1.p 170 KLFQRIWSDDDEITILKGMIDYSTKKGADPYSDMGAFHDFIKKSLKADVNKTQLQDKIRRIKKKYETNVAK---GKKYNPVKPHEQKLFDL 257
                         579********************************************************************...999999*********** PP

              DUF573  92 skkiWgs 98 
                         skk+Wgs
  Prupe.3G046700.1.p 258 SKKVWGS 264
                         *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.6E-33172263IPR007592Protein of unknown function DUF573
PROSITE profilePS5089314.933438660IPR003439ABC transporter-like
Gene3DG3DSA:3.40.50.3001.1E-30461639IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF525405.73E-30463634IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF000051.0E-17463588IPR003439ABC transporter-like
SMARTSM003824.5E-8469637IPR003593AAA+ ATPase domain
PROSITE patternPS002110560574IPR017871ABC transporter, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005524Molecular FunctionATP binding
GO:0016887Molecular FunctionATPase activity
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSEE EVASSEEEVD GEEEEESGSG SESESEEPEP PKAAPTPVAA  60
KKPDSATVNS KPQSSSSGSE SESESDSELD KDRVVKPIVS KPMEETPKTK KPRSKASAIT  120
TPAARAGLKR PSESDPKDSK RPKKKVTDPD QEREHAGEET KKAGGDDSKK LFQRIWSDDD  180
EITILKGMID YSTKKGADPY SDMGAFHDFI KKSLKADVNK TQLQDKIRRI KKKYETNVAK  240
GKKYNPVKPH EQKLFDLSKK VWGSGEGSIG LSGLSEQSKS NGKARTNQKG NKTLASLKAE  300
LLSSPERPKE CEKVEFGLKP CGSESLSEVI GFDKGFRELG LPEGVVKQGL ELIGGAKRAE  360
LKEKWKKLHV AELELFVKKS ELMRDQAKPG AFGVVTLPFS VREGINIFLS GFVPTENPRF  420
RDESLTFKVT ETPQESGEEI ETYARYGYPS MTKTLGEFKL QVIEGEFTNS QIIVMLGENG  480
SGKTTFMRML VGLSKPDSGV EIPELHVSYK NQKINPKRAT KVKDLLHEKI RDSCTHPQFV  540
TDVMKPLQIE QLMDQEITKL SGGELQRVAL CVCLGKPADI YLMDEPSAYL DSEQRIVAAK  600
VIKRFVLHAK KTAFVVGHDF IIATYLADKV IVYEGKSSVD CIANSPNQQI ESTNDTEQKA  660
SGSYYYLDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lzv_jj1e-128389669104599ABCE1
6hcf_k11e-128389669104599ATP binding cassette subfamily E member 1
6hcm_k11e-128389669104599ATP binding cassette subfamily E member 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.57930.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G046700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214850.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLA0A251PVI70.0A0A251PVI7_PRUPE; Uncharacterized protein
STRINGEMJ160490.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-27DNA-binding storekeeper protein-related transcriptional regulator