PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G040400.1.p
Common NamePRUPE_ppa022653mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 549aa    MW: 61096.3 Da    PI: 6.4099
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G040400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS261.92.1e-801575382374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++s+++ +++ pp + ++++     ++l  f+evsP++ 
  Prupe.3G040400.1.p 157 EQLLNPCALAITGGNLTRVQHLLYVLHELASLTGDANHRLAAHGLRALTQHLSSSGPNGSASAPPVTFASTEPRFFQKSLLKFYEVSPWFA 247
                         689******************************************************************8888888888888********* PP

                GRAS  93 fshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg...........skeeleetgerLak 167
                         f + +aN+ Il+ +++e    + +Hi+D ++s+G+QWp+Ll+aL+ Rp ++pp ++iT+v++++++                 +    L  
  Prupe.3G040400.1.p 248 FPNNIANSSILQLFAEEsdrtRNLHIVDVGVSHGMQWPTLLEALTRRPgGPPPLVKITVVSAAANTennqnretpfsIGPPGDNFSFSLLG 338
                         **************9998887889************************55566********99888666655544433344455666799* PP

                GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFle 255
                         fA+++++++++n l  + l++l+ + ++++++E+l+V+++++lh+l    +++++er+e+Lk++++++Pk v+++e+++++   n ++F++
  Prupe.3G040400.1.p 339 FAKSMNINLQINRLDNQPLQNLNAQVIDTSNDEMLIVCVQFRLHNLN---HNTPDERTEFLKALRNMEPKGVILSENNMECscnNCGDFAT 426
                         *************9999*****************************8...77777889*******************9665446778**** PP

                GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk. 345
                         +f++ +ey + ++ds+++ +    + r + Er++++ e+ ++++++g++    +e +ekW er++ +GF    ++e+a +  ++llrk++ 
  Prupe.3G040400.1.p 427 GFSRQVEYLWRFLDSTSSAF----KGRESDERRVMEGEAAKALTNRGEM----NEGKEKWCERMRGVGFVGQVFGEDAIDGGRALLRKYDs 509
                         ****************6665....5555556666666699999999998....9************************************9 PP

                GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++++rv+e++g++ l Wk++p+ ++S W+
  Prupe.3G040400.1.p 510 NWEMRVDEKDGCAGLWWKGQPVSFCSLWK 538
                         999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.475130517IPR005202Transcription factor GRAS
PfamPF035147.4E-78157538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MTTQEPEPNS TSDHILDWLE DSVTFFPTFL DNPYHSNDIN GLQWWDESHD LIHSNTTSTS  60
LNNPISIALP TTTRPQNPTN LNHQSPSDSS KKRKVSDDQH IDQKNHVRPI SLAGQGDQLV  120
DEVVVPVKRT NGNRKGTAKT TGNNCNNGNS KEGRWAEQLL NPCALAITGG NLTRVQHLLY  180
VLHELASLTG DANHRLAAHG LRALTQHLSS SGPNGSASAP PVTFASTEPR FFQKSLLKFY  240
EVSPWFAFPN NIANSSILQL FAEESDRTRN LHIVDVGVSH GMQWPTLLEA LTRRPGGPPP  300
LVKITVVSAA ANTENNQNRE TPFSIGPPGD NFSFSLLGFA KSMNINLQIN RLDNQPLQNL  360
NAQVIDTSND EMLIVCVQFR LHNLNHNTPD ERTEFLKALR NMEPKGVILS ENNMECSCNN  420
CGDFATGFSR QVEYLWRFLD STSSAFKGRE SDERRVMEGE AAKALTNRGE MNEGKEKWCE  480
RMRGVGFVGQ VFGEDAIDGG RALLRKYDSN WEMRVDEKDG CAGLWWKGQP VSFCSLWKTD  540
VKVMVTKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2018453825375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216829.10.0hypothetical protein PRUPE_ppa022653mg
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLM5X9410.0M5X941_PRUPE; Uncharacterized protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-169GRAS family protein