PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G027400.4.p
Common NamePRUPE_ppa005159mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 475aa    MW: 51971.8 Da    PI: 6.0045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G027400.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14.1e-33255309155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +pr+rWtpeLHerFveav++L G+ekAtPk +l++m+v+gLt++hvkSHLQkYRl
  Prupe.3G027400.4.p 255 RPRMRWTPELHERFVEAVNKLDGAEKATPKGVLKVMNVEGLTIYHVKSHLQKYRL 309
                         59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.432251312IPR017930Myb domain
SuperFamilySSF466899.85E-18254309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-31254310IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-25256310IPR006447Myb domain, plants
PfamPF002492.8E-9257308IPR001005SANT/Myb domain
PfamPF143794.7E-23345392IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MKVGLPSTIM SRHDIISVPQ SETTKEVTQS YCTPKSQMHD FLGSKSEGRS LAASECSSAR  60
LSPFIRAESL GSPTNIRGSS VQHSQNTFSR SSVFCTSLYQ SSSSSSETSR QLGNLPFLPH  120
PPTYSQSISA VDSKSPFLLS DNMSNQYDDE QSEDLMKDFL NLHGDGSHGS FHGISCGSDT  180
LALTEQLELQ FLSDQLDMAI TDNGENPGLD EIYEIPQASP KPAIGLTYSK SCRLTTLPVD  240
ALSSHPSPGP SPAHRPRMRW TPELHERFVE AVNKLDGAEK ATPKGVLKVM NVEGLTIYHV  300
KSHLQKYRLA KYMPEKREDK AASSSEEKKA ASSSSESDGR RKGSIQITEA LRMQMEVQKQ  360
LHEQLEVQRA LQLRIEDHAK YLQKILEEQQ KAGSALLSPQ ALSSLTTNSI QEPEQQPSSS  420
AGVSPTQPAE SDSSSPQSLK HKATDSSESE PPACTKKQRL EEKPDEGVVE NPQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-26255312259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G027400.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215324.10.0myb family transcription factor PHL6
RefseqXP_020415890.10.0myb family transcription factor PHL6
RefseqXP_020415891.10.0myb family transcription factor PHL6
RefseqXP_020415892.10.0myb family transcription factor PHL6
RefseqXP_020415893.10.0myb family transcription factor PHL6
RefseqXP_020415894.10.0myb family transcription factor PHL6
SwissprotQ949U21e-140PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLM5X4S60.0M5X4S6_PRUPE; Uncharacterized protein
STRINGEMJ165230.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-114G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]