PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G018800.1.p
Common NamePRUPE_ppa021873mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 152aa    MW: 17171.4 Da    PI: 6.8844
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G018800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.28.8e-4161061101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrrkCa+dCvlapyfp+++p++fa+vhk+FGa n++k+l++lp + re+a+++++yeA +r++dP+yG+v++i++lqq+l q++
  Prupe.3G018800.1.p   6 RCAGCKFLRRKCAQDCVLAPYFPSSNPERFACVHKIFGAGNITKMLQQLPVHVREAAADCMFYEASIRVEDPIYGCVKIISQLQQDLFQAQ 96 
                         6****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         +e+a++k+++
  Prupe.3G018800.1.p  97 SEMAKTKAQI 106
                         *****99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4345106IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-396103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MANPTRCAGC KFLRRKCAQD CVLAPYFPSS NPERFACVHK IFGAGNITKM LQQLPVHVRE  60
AAADCMFYEA SIRVEDPIYG CVKIISQLQQ DLFQAQSEMA KTKAQIAFYN AQQQLNQQQQ  120
NMVDGVDDNY QQDQHRESSR LGLDDHFYSL G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217370.11e-111hypothetical protein PRUPE_ppa021873mg
SwissprotP594684e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLM5WY371e-111M5WY37_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s13910.11e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.18e-45LOB domain-containing protein 24